Hepatitis B Surface Antigen, preS1 Recombinant

Product Name:Hepatitis B Surface Antigen, preS1 Recombinant

Catalog Number: LTP7831

Product Size: 50µg

Transportation method:Shipped at Room temp

Uniprot ACC#: Viral Antigens

Subcategory:HBsAg

Amino acid sequence: MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEAHQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQA.

The E.Coli derived Recombinant Hepatitis B Surface Antigen preS1 is a single non-glycosylated polypeptide chain containing 119 amino acids and having a molecular weight of 12.6 kDa.

Formulation:HBsAg protein was lyophilized from 0.2_m filtered (1mg/ml) solution in 20mM PB, pH 7.4, and 50mM NaCl.

Physical Appearance:

Purity:HBsAg Protein is >95% pure as determined by 10% PAGE (coomassie staining).

Source:Escherichia Coli.

Stability:This lyophilized HBsAg preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.

Synonyms:

Usage:LifeTein's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

  • 4 Units in Stock

Ask a Question

$475.00

Add to Cart:
LifeTein LifeTein provides custom peptide synthesis service, recombinant proteins, peptides, cytokines, custom antibody service and custom protein service. LifeTein is the world leader in fast peptide synthesis service with lab facility located in New Jersey USA. LifeTein Peptide 100 Randolph Road, Suite 2D, Somerset USA New Jersey 08873
Copyright © 2024 LifeTein.com. Powered by LifeTein