Product Name:Hepatitis B Surface Antigen, preS1 Recombinant
Catalog Number: LTP7831
Product Size: 50µg
Transportation method:Shipped at Room temp
Uniprot ACC#: Viral Antigens
Subcategory:HBsAg
Amino acid sequence: MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEAHQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQA.
The E.Coli derived Recombinant Hepatitis B Surface Antigen preS1 is a single non-glycosylated polypeptide chain containing 119 amino acids and having a molecular weight of 12.6 kDa.
Formulation:HBsAg protein was lyophilized from 0.2_m filtered (1mg/ml) solution in 20mM PB, pH 7.4, and 50mM NaCl.
Physical Appearance:
Purity:HBsAg Protein is >95% pure as determined by 10% PAGE (coomassie staining).
Source:Escherichia Coli.
Stability:This lyophilized HBsAg preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.
Synonyms:
Usage:LifeTein's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.