B-type Natriuretic Peptide Human Recombinant

Product Name:B-type Natriuretic Peptide Human Recombinant

Catalog Number: LTP2327

Product Size: 10µg

Transportation method:Shipped at Room temp

Uniprot ACC#: P16860Cytokines

Subcategory:B type Natriuretic Peptide

Amino acid sequence: SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH.

B-type Natriuretic Peptide Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 32 amino acids and having a molecular mass of 3464 Dalton. NPPB is purified by proprietary chromatographic techniques.

Formulation:Natriuretic Peptide Precursor B was lyophilized from 0.4ml PBS buffer containing 20mM phosphate buffer and 0.6mM sodium chloride.

Physical Appearance:Sterile Filtered White lyophilized (freeze-dried) powder.

Purity:Greater than 95.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.

Source:Escherichia Coli.

Stability:Lyophilized B-type Natriuretic Peptide although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution NPPB should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.

Synonyms: NPPB, Natriuretic Peptide Precursor B, BNP, B-type Natriuretic Peptide.

Usage:LifeTein's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

  • 4 Units in Stock

Ask a Question

$475.00

Add to Cart:
LifeTein LifeTein provides custom peptide synthesis service, recombinant proteins, peptides, cytokines, custom antibody service and custom protein service. LifeTein is the world leader in fast peptide synthesis service with lab facility located in New Jersey USA. LifeTein Peptide 100 Randolph Road, Suite 2D, Somerset USA New Jersey 08873
Copyright © 2024 LifeTein.com. Powered by LifeTein