Product Name:B-type Natriuretic Peptide Human
Catalog Number: LTP2328
Product Size: 25mg
Transportation method:Shipped at Room temp
Uniprot ACC#: P16860Cytokines
Subcategory:B type Natriuretic Peptide
Amino acid sequence: SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH.
B-type Natriuretic Peptide Human is a polypeptide chain containing 32 amino acids and having a molecular mass of 3464 Dalton. The molecular formula is:C143H244N50O42S4.
Formulation:The protein was lyophilized without additives.
Physical Appearance:Sterile Filtered White lyophilized (freeze-dried) powder.
Purity:Greater than 95.0% as determined by RP-HPLC.
Source:
Stability:Lyophilized B-type Natriuretic Peptide although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution B-type Natriuretic Peptide should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Synonyms: NPPB, Natriuretic Peptide Precursor B, BNP, B-type Natriuretic Peptide.
Usage:LifeTein's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
