West Nile Virus Pre-M Recombinant

Product Name:West Nile Virus Pre-M Recombinant

Catalog Number: LTP8134

Product Size: 500µg

Transportation method:Shipped with Ice Packs

Uniprot ACC#: Viral Antigens

Subcategory:West Nile

Amino acid sequence: MVTLSNFQGKVMMTVNATDVTDVITIPTAAGKNLCIVRA MDVGYLCEDTITYECPVLAAGNDPEDIDCWCTKSSVYVRYGRCTKTRHSRRSRRSLTVQTHGESTLANKKGAWLDSTKATRYLVKTESWILRNPGYALE.

The E.Coli derived 20kda recombinant protein contains the West-Nile N-Terminal Pre-M Virus immunodominant regions. The protein is fused with 6xHis tag.

Formulation:20mM phosphate buffer pH 7.5.

Physical Appearance:

Purity:Protein is >95% pure as determined by SDS-PAGE.

Source:Escherichia Coli.

Stability:WNV Pre-M although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.

Synonyms:

Usage:LifeTein's products are furnished for LABORATORY RESEARCH USE ONLY.They may not be used as drugs,agricultural or pesticidal products, food additives or household chemicals.

  • 4 Units in Stock

Ask a Question

$1,648.00

Add to Cart:
LifeTein LifeTein provides custom peptide synthesis service, recombinant proteins, peptides, cytokines, custom antibody service and custom protein service. LifeTein is the world leader in fast peptide synthesis service with lab facility located in New Jersey USA. LifeTein Peptide 100 Randolph Road, Suite 2D, Somerset USA New Jersey 08873
Copyright © 2023 LifeTein.com. Powered by LifeTein