Product Name:Vascular Endothelial Growth Factor C Human Recombinant HEK
Catalog Number: LTP4477
Product Size: 20µg
Transportation method:Shipped at Room temp
Uniprot ACC#: P49767Growth Factors
Subcategory:VEGF
Amino acid sequence: FESGLDLSDAEPDAGEATAYASKDLEEQLRSVSSVDELMTVLYPEYWKMYKCQLRKGGWQHNREQANLNSRTEETIKFAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRRVDHHHHHH.
VEGFC Human Recombinant produced by transfected human cells is a single polypeptide chain containing 204 amino acids (32-227). VEGFC is fused to an 8 amino acid His-tag at C-terminus & purified by proprietary chromatographic techniques.
Formulation:VEGFC was lyophilized from a 0.2 ?M filtered solution of 20mM Tris-HCl and 150mM NaCl, pH 7.2.
Physical Appearance:Sterile Filtered White lyophilized (freeze-dried) powder.
Purity:Greater than 95% as determined by SDS-PAGE.
Source:HEK293 cells.
Stability:Lyophilized VEGFC although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution VEGFC should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles.
Synonyms: VEGF-C, Vascular endothelial growth factor C, VRP, Flt4 ligand, Flt4-L, Vascular endothelial growth factor-related protein, VEGFC.
Usage:LifeTein's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
