Product Name:Vascular Endothelial Growth Factor (121 a.a.) Human Recombinant, Sf9
Catalog Number: LTP4456
Product Size: 10µg
Transportation method:Shipped at Room temp
Uniprot ACC#: P15692Growth Factors
Subcategory:VEGF
Amino acid sequence: APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPS CVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHN KCECRPKKDRARQEKCDKPRR.
Vascular Endothelial Growth Factor-121 Human Recombinant produced in insect cells as an 18kDa homodimer, is a glycosylated, polypeptide chain containing 121 amino acids and having a molecular mass of approximately 36kDa.VEGF121 circulates more freely than other VEGF forms, which bind more tightly with vascular heparin sulfates.The VEGF-121 is purified by proprietary chromatographic techniques.
Formulation:The protein was lyophilized from a solution containing 50mM acetic acid.
Physical Appearance:Sterile Filtered White lyophilized (freeze-dried) powder.
Purity:Greater than 95.0% as determined by SDS-PAGE.
Source:Sf9, Insect Cells.
Stability:Lyophilized Vascular Endothelial Growth Factor 121 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution VEGF-121 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Synonyms: Vascular endothelial growth factor A, VEGF-A, Vascular permeability factor, VPF, VEGF, MGC70609.
Usage:LifeTein's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
