Product Name:SARS MERS Spike S1 Recombinant
Catalog Number: LTP8095
Product Size: 500µg
Transportation method:Shipped with Ice Packs
Uniprot ACC#: AHC74088Viral Antigens
Subcategory:SARS
Amino acid sequence: EAKPSGSVVEQAEGVECDFSPLLSGTPPQVYNFKRLVFTNCNYNLTKLLSLFSVNDFTCSQISPAAIASNCYSSLILDYFSYPLSMKSDLSVSSAGPISQFNYKQSFSNPTCLILATVPHNLTTITKPLKYSYINKCSRLLSDDRTEVPQLVNANQYSPCVSIVPSTVWEDGDYYRKQLSPLEGGGWLVASGSTVAMTEQLQMGFGITVQYGTDTNSVCPKLEFANDTKIASQLGNCVEYHHHHHH.
Recombinant SARS MERS Spike S1 is a peptide from amino acids 56-295 of spike protein S1 produced in E. coli and fused to a 6xHis tag at its C-terminus (UniProt accession #AHC74088).SARS MERS is purified by a proprietary chromatographic technique.
Formulation:SARS MERS protein solution is supplied in PBS, 25mM arginine and 0.05% sodium azide.
Physical Appearance:Sterile filtered clear solution.
Purity:Protein is >95% pure as determined by 12% PAGE (coomassie staining).
Source:Escherichia Coli.
Stability:Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles.
Synonyms:
Usage:LifeTein's products are furnished for LABORATORY RESEARCH USE ONLY. They may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
