RQIKIWFQNRRMKWKKGLSMMRALHNFLTAGVPAEG

$1.00

Catalog Number:
5591
Category:
Peptide
Sequence:
RQIKIWFQNRRMKWKKGLSMMRALHNFLTAGVPAEG
Modifications:
Quantity:
100mg
Purity:
85.12 %
Notes:

Add to Cart:

  • 1 Units in Stock

Copyright © 2022 LifeTein.com. Powered by LifeTein