Product Name:Ras-Related C3 Botulinum Toxin substrate 1 Human Recombinant
Catalog Number: LTP7265
Product Size: 50µg
Transportation method:Shipped with Ice Packs
Uniprot ACC#: P63000Recombinant Proteins
Subcategory:Ras-Related C3 Botulinum Toxin Substrate
Amino acid sequence: MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCP PPVKKRKRKCLLL.
Ras-Related C3 Botulinum Toxin substrate 1 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 192 amino acids and having a molecular mass of 21.4 kDa.
Formulation:The protein solution contains 20mM Tris-HCl pH7.5, 2mM EDTA and 1mM DTT.
Physical Appearance:Sterile Filtered colorless solution.
Purity:Greater than 95.0% as determined by SDS-PAGE.
Source:Escherichia Coli.
Stability:Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles.
Synonyms: P21-RAC1, RAC-1, RAC1, RAS-like protein TC25, MIG5, Cell-migration-inducing gene 5 protein,Ras-related C3 botulinum toxin substrate 1, rho family small GTP binding protein Rac1, TC-25, MGC111543.
Usage:LifeTein's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
