Myelin Oligodendrocyte Glycoprotein Human Recombinant

Product Name:Myelin Oligodendrocyte Glycoprotein Human Recombinant

Catalog Number: LTP6315

Product Size: 50µg

Transportation method:Shipped at Room temp

Uniprot ACC#: Q16653Recombinant Proteins

Subcategory:Myelin Oligodendrocyte Glycoprotein

Amino acid sequence: MGQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPGHHHHHH.

Myelin Oligodendrocyte Glycoprotein produced in E.Coli is a single, non-glycosylated polypeptide chain containing a total of 132 amino acids (Met + 30-154 a.a. + 6x His tag at C-terminus) and having a total molecular mass of 15.2 kDa.

Formulation:The Myelin Oligodendrocyte Glycoprotein 0.5mg/ml solution was lyophilized from 20mM sodium acetate buffer pH-4 and 0.3M sodium chloride.

Physical Appearance:Sterile Filtered White lyophilized (freeze-dried) powder.

Purity:Greater than 95.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.

Source:Escherichia Coli.

Stability:Lyophilized MOG although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution MOG should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.

Synonyms: Myelin Oligodendrocyte Glycoprotein, MOG, MOGIG-2, MGC26137.

Usage:LifeTein's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

  • 4 Units in Stock

Ask a Question

$475.00

Add to Cart:
LifeTein LifeTein provides custom peptide synthesis service, recombinant proteins, peptides, cytokines, custom antibody service and custom protein service. LifeTein is the world leader in fast peptide synthesis service with lab facility located in New Jersey USA. LifeTein Peptide 100 Randolph Road, Suite 2D, Somerset USA New Jersey 08873
Copyright © 2024 LifeTein.com. Powered by LifeTein