Product Name:Macrophage Migration Inhibitory Factor Human Recombinant (Active)
Catalog Number: LTP4335
Product Size: 3x10µg
Transportation method:Shipped at Room temp
Uniprot ACC#: P14174Growth Factors
Subcategory:Macrophage Migration Inhibitory Factor
Amino acid sequence: MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA.
MIF human Recombinant was cloned into an E.coli expression vector and was purified to apparent homogeneity by using conventional column chromatography techniques.Macrophage Inducing Factor Human Recombinant is a single, non-glycosylated, polypeptide chain containing 115 amino acids and having a molecular mass of 12.5 kDa.
Formulation:MIF-Protein was lyophilized from 10mM sodium phosphate buffer pH-7.5.
Physical Appearance:Sterile Filtered White lyophilized (freeze-dried) powder.
Purity:Greater than 97.0% as determined by:(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Source:Escherichia Coli.
Stability:Lyophilized MIF-protein although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution MIF-protein should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Synonyms: Phenylpyruvate tautomerase, Glycosylation-inhibiting factor, GIF, MMIF, MIF.
Usage:LifeTein's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
