|
| [KD Validated] Calreticulin Rabbit mAb |
|
| LTA24716 |
|
| 100ul |
|
|
$750
In stock
|
|
| Calreticulin is a highly conserved chaperone protein which resides primarily in the endoplasmic reticulum, and is involved in a variety of cellular processes, among them, cell adhesion. Additionally, it functions in protein folding quality control and calcium homeostasis. Calreticulin is also found in the nucleus, suggesting that it may have a role in transcription regulation. Systemic lupus erythematosus is associated with increased autoantibody titers against calreticulin. Recurrent mutations in calreticulin have been linked to various neoplasms, including the myeloproliferative type. |
|
| RO; CRT; SSA; cC1qR; HEL-S-99n |
|
| 811,sc-7431,sc-6468,sc-6467,sc-11398,CALR,Calregulin,calreticulin,cC1qR,CRP55,CRT,CRTC,ERp60,grp60,HACBP,RO,SSA,HEL-S-99n,Sicca syndrome antigen A (autoantigen Ro,calreticulin),calregulin,endoplasmic reticulum resident protein 60,epididymis secretory sperm binding protein Li 99n,P27797,Calreticulin,Sicca Syndrome Antigen A (Autoantigen Ro,Calreticulin),Endoplasmic Reticulum Resident Protein 60,Grp60,Epididymis Secretory Sperm Binding Protein Li 99n,Autoantigen Ro,CC1qR |
|
| Human |
|
| 811 |
|
| P27797 |
|
| EPAVYFKEQFLDGDGWTSRWIESKHKSDFGKFVLSSGKFYGDEEKDKGLQTSQDARFYALSASFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPNSLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFL |
|
| Recombinant fusion protein containing a sequence corresponding to amino acids 18-203 of human Calreticulin (NP_004334.1). |
|
| Rabbit |
|
| Affinity Purified Monoclonal IgG |
|
| WB, ELISA |
|
| Human, Mouse, Rat |
|
| 47kDa |
|
| WB,1:2500 - 1:10000|ELISA,Recommended starting concentration is 1 _g/mL. Please optimize the concentration based on your specific assay requirements. |
|
|
Reconstituted antibodies stable at -80C for 12 months, 4C for 1 week. Avoid repeated freeze-thaw cycles.
|
|
|
Shipped at ambient temperature.
|
|
|
Centrifuge tubes before opening. Dissolve the lyophilized antibodies in distilled water. 5-10% glycerol is recommended.
|
|
| ![[KD Validated] Calreticulin Rabbit mAb]( /peptide-product/images/antibody-products/LTA24716/LTA24716_WB_01_(1166907).jpg )
Western blot analysis of lysates from wild type (WT) and Calreticulin knockdown (KD) 293T cells using [KD Validated] Calreticulin Rabbit mAb (LTA24716) at 1:5000 dilution incubated overnight at 4_.|Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (LT014) at 1:10000 dilution.|Lysates/proteins: 25 _g per lane.|Blocking buffer: 3% nonfat dry milk in TBST.|Detection: ECL Basic Kit (LT00020).|Exposure time: 45s. |
