Interleukin-6 Recombinant Human, CHO

Product Name:Interleukin-6 Recombinant Human, CHO

Catalog Number: LTP2534

Product Size: 20µg

Transportation method:Shipped with Ice Packs

Uniprot ACC#: P05231Cytokines

Subcategory:Interleukin

Amino acid sequence: VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

Interleukin-6 Human Recombinant produced in CHO is a 21-23kDa single, glycosylated polypeptide chain containing 183 amino acids.

Formulation:IL-6 is a sterile filtered (0.22?m) solution (0.22mg/ml) in 20mM Tris-HCl buffer pH 7.2.

Physical Appearance:Sterile filtered colorless solution.

Purity:Greater than 95.0% as determined by analysis by SDS-PAGE.

Source:Chinese Hamster Ovarian Cells.

Stability:Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles.

Synonyms: IFN-b2, B cell differentiation factor, BCDF, BSF-2, HPGF, HSF, MGI-2, B-cell stimulatory factor 2, Interferon beta-2, Hybridoma growth factor, CTL differentiation factor, CDF, IL-6, HGF.

Usage:LifeTein's products are furnished for LABORATORY RESEARCH USE ONLY. They may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

  • 4 Units in Stock

Ask a Question

$475.00

Add to Cart:
LifeTein LifeTein provides custom peptide synthesis service, recombinant proteins, peptides, cytokines, custom antibody service and custom protein service. LifeTein is the world leader in fast peptide synthesis service with lab facility located in New Jersey USA. LifeTein Peptide 100 Randolph Road, Suite 2D, Somerset USA New Jersey 08873
Copyright © 2023 LifeTein.com. Powered by LifeTein