Product Name:Interleukin-6 Recombinant Human, CHO
Catalog Number: LTP2534
Product Size: 20µg
Transportation method:Shipped with Ice Packs
Uniprot ACC#: P05231Cytokines
Subcategory:Interleukin
Amino acid sequence: VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Interleukin-6 Human Recombinant produced in CHO is a 21-23kDa single, glycosylated polypeptide chain containing 183 amino acids.
Formulation:IL-6 is a sterile filtered (0.22?m) solution (0.22mg/ml) in 20mM Tris-HCl buffer pH 7.2.
Physical Appearance:Sterile filtered colorless solution.
Purity:Greater than 95.0% as determined by analysis by SDS-PAGE.
Source:Chinese Hamster Ovarian Cells.
Stability:Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles.
Synonyms: IFN-b2, B cell differentiation factor, BCDF, BSF-2, HPGF, HSF, MGI-2, B-cell stimulatory factor 2, Interferon beta-2, Hybridoma growth factor, CTL differentiation factor, CDF, IL-6, HGF.
Usage:LifeTein's products are furnished for LABORATORY RESEARCH USE ONLY. They may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
