Product Name:Interleukin-19 Mouse Recombinant
Catalog Number: LTP2652
Product Size: 10µg
Transportation method:Shipped at Room temp
Uniprot ACC#: Q8CJ70Cytokines
Subcategory:Interleukin
Amino acid sequence: MLRRCLISVDMRLIEKSFHEIKRAMQTKDTFKNVTILSLENLRSIKPGDVCCMTNNLLTFYRDRVFQDHQERSLEVLRRISSIANSFLCVQKSLERCQVHRQCNCSQEATNATRIIHDNYNQLEVSSAALKSLGELNILLAWIDRNHLETPAA.
Interleukin-19 Mouse Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 153 amino acids and having a molecular mass of 17.7kDa. The IL-19 is purified by proprietary chromatographic techniques.
Formulation:Lyophilized from a sterile filtered aqueous solution containing 5mM Na3PO4 and 150mM NaCl, pH 7.5.
Physical Appearance:Sterile Filtered White lyophilized (freeze-dried) powder.
Purity:Greater than 95.0% as determined by SDS-PAGE.
Source:Escherichia Coli.
Stability:Lyophilized Interleukin-19 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL19 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Synonyms: Interleukin-19, IL-19, Il19.
Usage:LifeTein's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.