Product Name:Interleukin-13 Human Recombinant
Catalog Number: LTP2570
Product Size: 10µg
Transportation method:Shipped at Room temp
Uniprot ACC#: P35225Cytokines
Subcategory:Interleukin
Amino acid sequence: GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN.
Interleukin-13 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 112 amino acids and having a molecular mass of 12 kDa. The IL-13 is purified by proprietary chromatographic techniques.
Formulation:The protein (1mg/ml) was lyophilized with 1xPBS pH-7.2 & 5% trehalose.
Physical Appearance:Sterile Filtered White lyophilized (freeze-dried) powder.
Purity:Greater than 95% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
Source:Escherichia Coli.
Stability:Lyophilized Interleukin-13 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL13 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Synonyms: NC30, ALRH, BHR1, P600, IL-13, MGC116786, MGC116788, MGC116789.
Usage:LifeTein's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.