Product Name:Interferon-Alpha 2b Human Recombinant
Catalog Number: LTP2440
Product Size: 100µg
Transportation method:Shipped at Room temp
Uniprot ACC#: Q86UP4Cytokines
Subcategory:Interferon
Amino acid sequence: MCDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLF STMDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSP CAWEVVRAEIMRSFSLSTNLQESLRSKE.
Interferon-a 2b Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 166 amino acids and having a molecular mass of 19400 Dalton.The Interferon-alpha 2b gene was obtained from human leukocytes.The IFN-a 2b is purified by proprietary chromatographic techniques.
Formulation:Lyophilized from a (1 mg/ml) solution in containing 2.3 mg Sodium phosphate dibasic and 0.55 mg sodium phosphate monobasic buffer.
Physical Appearance:Sterile Filtered White lyophilized (freeze-dried) powder.
Purity:Greater than 98.0% as determined by(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
Source:Escherichia Coli.
Stability:Lyophilized Interferon although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IFN alpha 2b should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Synonyms: Interferon alpha 2b, IFNA, INFA2, MGC125764, MGC125765.
Usage:LifeTein's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
