Product Name:Human Papillomavirus 11 Recombinant
Catalog Number: LTP8081
Product Size: 500µg
Transportation method:Shipped with Ice Packs
Uniprot ACC#: Viral Antigens
Subcategory:Papillomavirus
Amino acid sequence: VDKLWRPSDSTVYVPPPNPVSKVVATDAYVKRTNIFYHASSSRLLAVGHPYYSIKKVNKTVVPKVSGYQYRVFKVVLPDPNKFALPDSSLFDPTTQRLVWACTGLEVGRGQPLGVGVSGHPLLNKYDDVENSGGYGGNPGQDNRVNVGMDYKQTQLCMVGCAPPLGEHWGKGTQCSNTSVQNGDCPPLELITSVIQDGDMVDTGFGAMNFADLQTNKSDVPLDICGTVCKYPDYLQMAADPYGDRLFFYLRKEQMFARHFFNRAGTVGEPVPDDLLVKGGNNRSSVASSIYVHTPSGSLVSSEAQLFNKPYWLQKAQGHNNGICWGNHLFVTVVDTTRSTNMTLCASVSKSATYTNSDYKEYMRHVEEFDLQFIFQLCSITLSAEVMAYIHTMNPSVLEDWNFGLSPPPNGTLEDTYRYVQSQAITCQKPTPEKEKQDPYKDMSFWEVNLKEKFSSELDQFPLGRKFLLQSGYRGRTSARTGIKRPAVSKPSTAPKRKRTKTKKKFGTKLSR.
Recombinant HPV-11 antigen is a 58.1kDa protein covering the full length of HPV-11 major capsid, its N-terminus is fused with a GST tag, having a total molecular weight of 84kDa. The HPV-11 was purified by proprietary chromatographic technique.
Formulation:Recombinant HPV11 solution in PBS, 3M Urea and 100mM arginine.
Physical Appearance:Sterile filtered clear liquid formulation.
Purity:Protein is >90% pure as determined by 10% PAGE (coomassie staining).
Source:E.Coli.
Stability:Recombinant HPV-11 although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
Synonyms: Papillomavirus, HPV, Papilloma Virus.
Usage:LifeTein's products are furnished for LABORATORY RESEARCH USE ONLY. They may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
