Product Name:Growth Hormone Binding Protein Rabbit Recombinant
Catalog Number: LTP4250
Product Size: 20µg
Transportation method:Shipped at Room temp
Uniprot ACC#: P19941Growth Factors
Subcategory:Growth Hormone
Amino acid sequence: AFSGSEATPATLGRASESVQRVHPGLGTNSSGKPKFTKCRSPELETFSCHWTDGVHHGLKSPGSVQLFYIRRNTQEWTQEWKECPDYVSAGENSCYFNSSYTSIWIPYCIKLTNNGGMVDQKCFSVEEIVQPDPPIGLNWTLLNVSLTGIHADIQVRWEPPPNADVQKGWIVLEYELQYKEVNETQWKMMDPVLSTSVPVYSLRLDKEYEVRVRSRQRSSEKYGEFSEVLYVTLPQMSPFTCEEDFRFP.
Growth Hormone Binding Protein Rabbit Extracellular Domain Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 249 amino acids and having a molecular mass of 28 kDa. GHBP Rabbit is purified by proprietary chromatographic techniques.
Formulation:The Growth Hormone Binding Protein Rabbit was lyophilized from a concentrated (1mg/ml) solution with 0.0045mM NaHCO3.
Physical Appearance:Sterile Filtered White lyophilized (freeze-dried) powder.
Purity:Greater than 98.0% as determined bySDS-PAGE.
Source:Escherichia Coli.
Stability:Lyophilized Growth Hormone Binding Protein Rabbit although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution GHBP Rabbit should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Synonyms: GHR, GHBP, GH receptor, Somatotropin receptor.
Usage:LifeTein's products are furnished for LABORATORY RESEARCH USE ONLY. They may not be used as drugs,agricultural or pesticidal products, food additives or household chemicals.
