Product Name:Granulysin Human Recombinant
Catalog Number: LTP7123
Product Size: 10µg
Transportation method:Shipped at Room temp
Uniprot ACC#: P22749Recombinant Proteins
Subcategory:Other
Amino acid sequence: MGSSHHHHHHSSGLVPRGSHMMEGLVFSRLSPEYYDLARAHLRDEEKSCPCLAQEGPQGDLLTKTQELGRDYRTCLTIVQKLKKMVDKPTQRSVSNAATRVCRTGRSRWRDVCRNFMRRYQSRVTQGLVAGETAQQICEDLRLCIPSTGPLGSHHHHHH.
GNLY Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 159 amino acids and fused to a double His Tag (N+C terminus) and having a total molecular mass of 18.1 kDa.The GNLY is purified by proprietary chromatographic techniques.
Formulation:The Granulysin protein was lyophilized from a concentrated (1mg/ml) solution containing no additives.
Physical Appearance:Sterile Filtered White lyophilized (freeze-dried) powder.
Purity:Greater than 95.0% as determined by SDS-PAGE.
Source:Escherichia Coli.
Stability:Lyophilized Granulysin although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Granulysin should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Synonyms: LAG2, Lymphokine LAG-2, TLA519, NKG5, LAG2, D2S69E, Granulysin, T-cell activation protein 519, GNLY, D2S69E.
Usage:LifeTein's products are furnished for_LABORATORY RESEARCH_USE_ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
