|
| CD304/Neuropilin-1 Rabbit mAb |
|
| LTA24821 |
|
| 100ul |
|
|
$750
In stock
|
|
| Enables protein kinase binding activity; transmembrane signaling receptor activity; and vascular endothelial growth factor binding activity. Involved in several processes, including nervous system development; regulation of signal transduction; and vasculature development. Acts upstream of or within several processes, including morphogenesis of a branching epithelium; nervous system development; and toxin transport. Located in several cellular components, including endosome; focal adhesion; and neurofilament. Is integral component of postsynaptic membrane. Is expressed in several structures, including cardiovascular system; jaw; lung; nervous system; and sensory organ. Used to study retinal vein occlusion. Human ortholog(s) of this gene implicated in lung non-small cell carcinoma. Orthologous to human NRP1 (neuropilin 1). |
|
| Nrp; NP-1; Npn1; NPN-1; C530029I03 |
|
| Nrp; NP-1; Npn1; NPN-1; C530029I03 |
|
| Human |
|
| 18186 |
|
| P97333 |
|
| FRSDKCGGTIKIENPGYLTSPGYPHSYHPSEKCEWLIQAPEPYQRIMINFNPHFDLEDRDCKYDYVEVIDGENEGGRLWGKFCGKIAPSPVVSSGPFLFIKFVSDYETHGAGFSIRYEIFKRGPECSQNYTAPTGVIKSPGFPEKYPNSLECTYIIFAPKMSEIILEFESFDLEQDSNPPGGMFCRYDRLEIWDGFPEVGPHIGRYCGQKTPGRIRSSSGVLSMVFYTDSAIAKEGFSANYSVLQSSISEDFKCM |
|
| Recombinant fusion protein containing a sequence corresponding to amino acids 22-856 of mouse CD304/Neuropilin-1 (NP_032763.2). |
|
| Rabbit |
|
| Affinity Purified Monoclonal IgG |
|
| WB, ELISA |
|
| Human, Mouse, Rat |
|
| 103kDa |
|
| WB,1:1000 - 1:2000|ELISA,Recommended starting concentration is 1 _g/mL. Please optimize the concentration based on your specific assay requirements. |
|
|
Reconstituted antibodies stable at -80C for 12 months, 4C for 1 week. Avoid repeated freeze-thaw cycles.
|
|
|
Shipped at ambient temperature.
|
|
|
Centrifuge tubes before opening. Dissolve the lyophilized antibodies in distilled water. 5-10% glycerol is recommended.
|
|
| .jpg )
Western blot analysis of lysates from Rat brain using CD304/Neuropilin-1 Rabbit mAb (LTA24821) at 1:1000 dilution incubated overnight at 4_.|Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (LT014) at 1:10000 dilution.|Lysates/proteins: 25 _g per lane.|Blocking buffer: 3% nonfat dry milk in TBST.|Detection: ECL Basic Kit (LT00020).|Exposure time: 45s. |
