Product Name:Bone Morphogenetic Protein-7 Human Recombinant, Plant
Catalog Number: LTP2353
Product Size: 10µg
Transportation method:Shipped at Room temp
Uniprot ACC#: P18075Cytokines
Subcategory:Bone Morphogenetic Protein
Amino acid sequence: HHHHHHSTGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSVILKKYRNMVVRACGCH.
Bone Morphogenetic Protein-7 Human Recombinant produced in Plant is a monomeric, glycosylated, polypeptide chain containing 144 amino acids and having a molecular mass of 16.5kDa, and fused to a 6xHis-tag at the N-terminus. The BMP-7 is purified by proprietary chromatographic techniques.
Formulation:BMP-7 was lyophilized from a solution containing Tris-HCl 0.05M buffer at pH 7.4.
Physical Appearance:Sterile Filtered White lyophilized (freeze-dried) powder.
Purity:Greater than 97.0% as determined by SDS-PAGE.
Source:Nicotiana benthamiana.
Stability:Lyophilized BMP-7 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution BMP 7 Human should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Synonyms: Osteogenic Protein 1, BMP-7.
Usage:LifeTein's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.