B-cell Activating Factor Receptor Human Recombinant

Product Name:B-cell Activating Factor Receptor Human Recombinant

Catalog Number: LTP2333

Product Size: 50µg

Transportation method:Shipped at Room temp

Uniprot ACC#: Q96RJ3Cytokines

Subcategory:B-Cell Activating Factor

Amino acid sequence: MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAALPLPG.

B Lymphocyte Stimulator Receptor Human Recombinant extracellular produced in E.Coli is a single, non-glycosylated polypeptide chain containing 76 amino acids and having a molecular mass of 7.7 kDa.The BAFF-R is purified by proprietary chromatographic techniques.

Formulation:Lyophilized from a 0.2_m filtered concentrated (1.0mg/ml) solution in 20mM PB, pH 8.0, 500mM NaCl.

Physical Appearance:Sterile Filtered White lyophilized (freeze-dried) powder.

Purity:Greater than 95.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.

Source:Escherichia Coli.

Stability:Lyophilized BAFF-R although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution B Lymphocyte Stimulator Receptor should be stored at 4°C between 2-7 days and for future use below -18°C.Please prevent freeze-thaw cycles.

Synonyms: TNFRSF13C, CD268, BAFF-R, MGC138235, B cell-activating factor receptor.

Usage:LifeTein's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

  • 4 Units in Stock

Ask a Question

$475.00

Add to Cart:
LifeTein LifeTein provides custom peptide synthesis service, recombinant proteins, peptides, cytokines, custom antibody service and custom protein service. LifeTein is the world leader in fast peptide synthesis service with lab facility located in New Jersey USA. LifeTein Peptide 100 Randolph Road, Suite 2D, Somerset USA New Jersey 08873
Copyright © 2024 LifeTein.com. Powered by LifeTein