Product Name:Adiponectin Human Recombinant
Catalog Number: LTP2275
Product Size: 25µg
Transportation method:Shipped with Ice Packs
Uniprot ACC#: Q15848Cytokines
Subcategory:Adiponectin
Amino acid sequence: MGHDQETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN.
The Adiponectin Human recombinant protein is a single, non-glycosilated polypeptide chain produced in E. coli, having a molecular weight of 25.1 kDa and containing 231 amino acids (15-244).
Formulation:Acrp30 protein solution contains Phosphate buffered saline pH 7.4 and 1mM DTT.
Physical Appearance:Sterile Filtered clear solution.
Purity:Acrp30 purity is greater than 90% as determined by SDS-PAGE.
Source:Escherichia Coli.
Stability:Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles.
Synonyms: Acrp30, AdipoQ, GBP-28, APM-1, ACDC.
Usage:LifeTein's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
