Adiponectin Human Recombinant

Product Name:Adiponectin Human Recombinant

Catalog Number: LTP2275

Product Size: 25µg

Transportation method:Shipped with Ice Packs

Uniprot ACC#: Q15848Cytokines

Subcategory:Adiponectin

Amino acid sequence: MGHDQETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN.

The Adiponectin Human recombinant protein is a single, non-glycosilated polypeptide chain produced in E. coli, having a molecular weight of 25.1 kDa and containing 231 amino acids (15-244).

Formulation:Acrp30 protein solution contains Phosphate buffered saline pH 7.4 and 1mM DTT.

Physical Appearance:Sterile Filtered clear solution.

Purity:Acrp30 purity is greater than 90% as determined by SDS-PAGE.

Source:Escherichia Coli.

Stability:Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles.

Synonyms: Acrp30, AdipoQ, GBP-28, APM-1, ACDC.

Usage:LifeTein's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

  • 4 Units in Stock

Ask a Question

$475.00

Add to Cart:
LifeTein LifeTein provides custom peptide synthesis service, recombinant proteins, peptides, cytokines, custom antibody service and custom protein service. LifeTein is the world leader in fast peptide synthesis service with lab facility located in New Jersey USA. LifeTein Peptide 100 Randolph Road, Suite 2D, Somerset USA New Jersey 08873
Copyright © 2023 LifeTein.com. Powered by LifeTein