PeptideSyn^TM Peptide Synthesis Technology

Conventional solid phase peptide synthesis (SPPS) typically uses a long coupling time of one hour or more, extended deprotection times, multiple wash steps, and Kaiser tests to ensure complete acylation. This time-consuming long-synthesis process can be especially troublesome when synthesizing the complex peptides such as beta-amyloid. The C-terminal segment of beta-amyloid has high hydrophobicity and is subject to subsequent on-resin aggregation. The rate of amino acid acylation is heavily dependent on the properties of the coupling. For this reason, the ability to assemble quality peptides faster is highly desirable.

LifeTein's PeptideSyn^TM technology is a very practical platform for the synthesis of peptides for research use and pharmaceutical purposes. PeptideSyn^TM technology has been used for in-house testing of multiple selected biologically active peptides. These have covered a broad range including long and short peptides and peptides containing D-amino acids or pseudoproline dipeptides. The processes have used various coupling reagents such as HBTU, HATU, HCTU, ByBroP, BOP, PyBOP, and TBTU. PeptideSyn^TM technology allows us the flexibility to choose affordable, highly efficient coupling reagents for fast SPPS.

One study that used PeptideSyn^TM technology found that the synthesis of the human beta-amyloid (1-42) peptide (H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH) using HCTU as an activator required a total synthesis time of only 15 hours and produced peptides of similar purity to those generated by long synthesis. Wang-ChemMatrix, HMPB-ChemMatrix, and Wang-PSLL were compared for their ability to affect the efficiency of different synthesis procedures. The C-terminal pentapeptide was incorporated by stepwise synthesis. The coupling yields for the peptide segment were 90 to 95%. After treatment with hydrogen fluoride and purification, synthetic human beta-amyloid (1-42) peptide was obtained in an overall yield of 75-88%.

Using appropriate coupling and deprotectant reagents linked to the correct resin, LifeTein's PeptideSyn^TM technology provides our customers with reduced total peptide synthesis time and higher quality.

Case Study: A client requested a very hydrophobic 68-amino-acid peptide (85% purity) with FITC modification at the N terminus. The peptide was successfully synthesized in 4 weeks.

HPLC Results

Mass Spectrometry Results