|
| XRCC2 Rabbit mAb |
|
| LTA24708 |
|
| 100ul |
|
|
$750
In stock
|
|
| This gene encodes a member of the RecA/Rad51-related protein family that participates in homologous recombination to maintain chromosome stability and repair DNA damage. This gene is involved in the repair of DNA double-strand breaks by homologous recombination and it functionally complements Chinese hamster irs1, a repair-deficient mutant that exhibits hypersensitivity to a number of different DNA-damaging agents. |
|
| FANCU; POF17; SPGF50 |
|
| 7516,sc-5895,sc-5896,DKFZp781P0919,DNA repair protein XRCC2,XRCC2,FANCU,X-ray repair cross complementing 2,X-ray repair complementing defective repair in Chinese hamster cells 2,X-ray repair cross-complementing protein 2,O43543,X-Ray Repair Cross Complementing 2,X-Ray Repair Complementing Defective Repair In Chinese Hamster Cells 2,X-Ray Repair Cross-Complementing Protein 2,DNA Repair Protein XRCC2,RAD51-Like |
|
| Human |
|
| 7516 |
|
| O43543 |
|
| MCSAFHRAESGTELLARLEGRSSLKEIEPNLFADEDSPVHGDILEFHGPEGTGKTEMLYHLTARCILPKSEGGLEVEVLFIDT |
|
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-83 of human XRCC2 (NP_005422.1). |
|
| Rabbit |
|
| Affinity Purified Monoclonal IgG |
|
| WB, ELISA |
|
| Human, Mouse, Rat |
|
| 32kDa |
|
| WB,1:1000 - 1:6000|ELISA,Recommended starting concentration is 1 _g/mL. Please optimize the concentration based on your specific assay requirements. |
|
|
Reconstituted antibodies stable at -80C for 12 months, 4C for 1 week. Avoid repeated freeze-thaw cycles.
|
|
|
Shipped at ambient temperature.
|
|
|
Centrifuge tubes before opening. Dissolve the lyophilized antibodies in distilled water. 5-10% glycerol is recommended.
|
|
| .jpg )
Western blot analysis of various lysates using XRCC2 Rabbit mAb (LTA24708) at 1:1000 dilution incubated overnight at 4_.|Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (LT014) at 1:10000 dilution.|Lysates/proteins: 25 _g per lane.|Blocking buffer: 3% nonfat dry milk in TBST.|Detection: ECL Basic Kit (LT00020).|Exposure time: 3s. |
