|
| Synapsin-1 Rabbit mAb |
|
| LTA24797 |
|
| 100ul |
|
|
$750
In stock
|
|
| This gene is a member of the synapsin gene family. Synapsins encode neuronal phosphoproteins which associate with the cytoplasmic surface of synaptic vesicles. Family members are characterized by common protein domains, and they are implicated in synaptogenesis and the modulation of neurotransmitter release, suggesting a potential role in several neuropsychiatric diseases. This member of the synapsin family plays a role in regulation of axonogenesis and synaptogenesis. The protein encoded serves as a substrate for several different protein kinases and phosphorylation may function in the regulation of this protein in the nerve terminal. Mutations in this gene may be associated with X-linked disorders with primary neuronal degeneration such as Rett syndrome. Alternatively spliced transcript variants encoding different isoforms have been identified. |
|
| SYNI; EPILX; MRX50; SYN1a; SYN1b; EPILX1 |
|
| 6853,sc-8295,sc-55774,sc-7379,sc-20780,Brain protein 4.1,SYN1,SYN1a,SYN1b,Synapsin 1,synapsin I,SYNI,synapsin-1,brain protein 4.1,synapsin Ib,P17600,Synapsin I,Brain Protein 4.1,Synapsin Ib,Synapsin-1 |
|
| Human |
|
| 6853 |
|
| P17600 |
|
| EDKQLIVELVVNKMAQALPRQRQRDASPGRGSHGQTPSPGALPLGRQTSQQPAGPPAQQRPPPQGGPPQPGPGPQRQGPPLQQRPPPQGQQHLSGLGPPA |
|
| A synthetic peptide corresponding to a sequence within amino acids 401-500 of human Synapsin-1 (NP_008881.2_,). |
|
| Rabbit |
|
| Affinity Purified Monoclonal IgG |
|
| IF/ICC, ELISA |
|
| Mouse, Rat |
|
| 74kDa |
|
| IF/ICC,1:200 - 1:800|ELISA,Recommended starting concentration is 1 _g/mL. Please optimize the concentration based on your specific assay requirements. |
|
|
Reconstituted antibodies stable at -80C for 12 months, 4C for 1 week. Avoid repeated freeze-thaw cycles.
|
|
|
Shipped at ambient temperature.
|
|
|
Centrifuge tubes before opening. Dissolve the lyophilized antibodies in distilled water. 5-10% glycerol is recommended.
|
|
| .jpg )
Confocal imaging of paraffin-embedded Mouse brain tissue using Synapsin-1 Rabbit mAb (LTA24797, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (LT007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x. |
