My Account Information
Displaying 21 to 30 (of 75 Products)
| Price | Product Name |
|---|---|
$350.00 $99.00Save: 72% off ... more info |
Corticotropin Releasing Factor, human, rat [86784-80-7] Catalog Number: LT8173 Category: Peptide Sequence: SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2, amidation Chemistry : Sequence:... |
$350.00 $99.00Save: 72% off ... more info |
Catalog Number: LT8172 Category: Peptide Sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2, amidation Chemistry : Sequence: NH2- His - Gly - Glu - Gly - Thr - Phe - Thr - Ser - Asp - Leu - Ser - Lys - Gln - Met - Glu - Glu - Glu - Ala -... |
$350.00 $99.00Save: 72% off ... more info |
Catalog Number: LT8171 Category: Peptide Sequence: IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2, amidation Chemistry : Sequence:... |
$540.00 $399.00Save: 26% off ... more info |
Product NameAc-IEAR-pNAProduct Quantity10mgCatalog NumberLT0848Molecular Weight649.7FormulaC28H43N9O9Sequence Ac-Ile-Glu-Ala-Arg-pNA, Ac-IEAR-pNA Description Ac-IEAR-pNA is a peptide substrate used in laboratories to measure the activity of... |
$3,039.00 $2,363.00Save: 22% off ... more info |
Biotinylated Human Claudin 6 Protein-VLP (LTP10615) Product NameBiotinylated Human Claudin 6 Protein-VLP (LTP10615) Catalog NumberLTP10615 Quantity100ug Price $ 3039 In stock BackgroundClaudin-6 is a multipass transmembrane protein in the Claudin family. Claudin-6 is expressed by epithelial... |
$250.00 $195.00Save: 22% off ... more info |
Neurokinin A; Substance K; Neuromedin L; NKA Product Name Neurokinin A; Substance K; Neuromedin L; NKA Product Quantity5mgCatalog Number LT1876Molecular Weight1133.34FormulaC50H80N14O14S Cas#86933-74-6 SequenceHKTDSFVGLM, His-Lys-Thr-Asp-Ser-Phe-Val-Gly-Leu-Met-NH2 Description Neurokinin A,... |
$550.00 $320.00Save: 42% off ... more info |
Catalog Number: 5602 Category: Peptide Sequence:BIRD-2 peptide: RKKRRQRRRGGNVYTEIKCNSLLPLAAIVRV Description: BIRD-2, a peptide that specifically disrupts the Bcl2/IP3R complex, was utilized to further verify the mitochondrial Ca2+... |
$280.00 $219.00Save: 22% off ... more info |
Catalog Number: 5549 Category: Peptide Sequence:HIV TAT (48-60): GRKKRRQRRRPPQ Modifications: This is one of the cell-penetrating peptides (CPPs) derived from the human immunodeficient virus (HIV)-1 Tat protein residue 48-60. It has been used... |
$262.00 $162.00Save: 38% off ... more info |
Product NameHIV-1 tat Protein (47-57)Product Quantity5mg Product Description This is the most characterized fragment of the HIV transactivator protein (TAT) YGRKKRRQRRR. This arginine-rich TAT peptide penetrates plasma membrane directly, but not... |
$262.00 $162.00Save: 38% off ... more info |
HIV-1 TAT-derived GRKKRRQRRRPQ Product NameTAT Cell-Penetrating Peptide, GRKKRRQRRRPQProduct Quantity5mg Catalog Number LT8314Molecular Weight 1621.93FormulaC65H124N34O15Sequence Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Arg-Pro-Gln, GRKKRRQRRRPQ Product Description The... |
Displaying 21 to 30 (of 75 Products)
