My Account Information
Displaying 11 to 20 (of 75 Products)
| Price | Product Name |
|---|---|
$180.00 $149.00Save: 17% off ... more info |
Catalog Number:LT0422 Lot Number:411005100206 Isotype:Mouse IgG3 Clonality:HA.C5 Quantity:50 μg, lyophilized with PBS, pH7.4 Positive Control:Purchase matching Western Blot positive control protein Immunogen:HA tag Peptide C-YPYDVPDYA synthetic... |
$240.00 $190.00Save: 21% off ... more info |
Catalog Number:LT9993 Lot Number:411005100209 Isotype:Mouse IgG1 Clonality:RF5R Quantity:50 μg, lyophilized with PBS, pH7.4 Immunogen:RFP from the Discosoma sea anemone N-terminal peptide-KLH conjugates Specificity:Recognizes native and... |
$240.00 $149.00Save: 38% off ... more info |
Catalog Number:LT9994 Lot Number:411005100210 Isotype:Mouse IgG1 Clonality:GF28R Quantity:50 μg, Lyophilized with PBS, pH7.4 Positive Control:Purchase matching Western Blot positive control protein Immunogen:GFP from the jellyfish Aequorea... |
$200.00 $149.00Save: 26% off ... more info |
Product NameBp100Product Quantity 4mg, >95% HPLCCatalog Number LT2538Molecular Weight1420.87FormulaC126H233N53O21 Sequence KKLFKKILKYL-NH2. BP100 was originally designed and optimized as an antimicrobial peptide to protect against plant... |
$350.00 $250.00Save: 29% off ... more info |
Catalog Number: 5754, LT119950 Quantity: 4 mg Purity: >95% Image: Category: OPA1 FRET Peptide Description: MCA-AFRATDHG-{Lys(DNP)}; N-terminal: MCA (7-methoxycoumarin-4-yl-acetyl) fluorophore; C-terminal: (Lys)-DNP (2,4... |
$350.00 $250.00Save: 29% off ... more info |
human Apolipoprotein E (ApoE) peptide Catalog Number: 5888, LT26009 Category: Peptide Sequence:Apolipoprotein E (apoE): CGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRD Description: Apolipoprotein E (ApoE) is the most effective peptide to deliver the lysosomal enzyme arylsulfatase A (ASA)... |
$250.00 $149.00Save: 40% off ... more info |
Product NameFmoc-C(Bhoc)-Aeg-OHProduct Quantity 1 GramCatalog Number LT-PNA007 Purity >95% CAS Number 186046-81-1 Molecular Formula C39H35N5O8 Molecular Weight 701.72 Description Description: Fmoc-PNA-C(Bhoc)-OH is designed for the... |
$250.00 $149.00Save: 40% off ... more info |
Product NameFmoc-G(Bhoc)-Aeg-OHProduct Quantity 1 GramCatalog Number LT-PNA006 Purity >95% CAS Number 186046-83-3 Molecular Formula C40H35N7O8 Molecular Weight 741.75 Description Description: Fmoc-PNA-G(Bhoc)-OH, representing the Guanine... |
$250.00 $149.00Save: 40% off ... more info |
Product NameFmoc-T-Aeg-OH; Fmoc-PNA-T-OHProduct Quantity 1 GramCatalog Number LT-PNA005 Purity >95% CAS Number 169396-92-3 Molecular Formula C26H26N4O7 Molecular Weight 506.51 Description Description: Fmoc-PNA-T-OH is a specialized monomer... |
$250.00 $149.00Save: 40% off ... more info |
Product NameFmoc-A(Bhoc)-Aeg-OHProduct Quantity 1 GramCatalog Number LT-PNA004 Purity >95% CAS Number 186046-82-2 Molecular Formula C40H35N7O7 Molecular Weight 725.75 Description Description: Fmoc-PNA-A(Bhoc)-OH is a specialized monomer... |
Displaying 11 to 20 (of 75 Products)
