Small Ubiquitin-Related Modifier 2 Human Recombinant

Product Name:Small Ubiquitin-Related Modifier 2 Human Recombinant

Catalog Number: LTP7659

Product Size: 50µg

Transportation method:Shipped with Ice Packs

Uniprot ACC#: P61956Recombinant Proteins

Subcategory:Ubiquitin

Amino acid sequence: MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG.

SUMO2 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 93 amino acids and having a molecular mass of 10.6 kDa.The SUMO-2 is purified by proprietary chromatographic techniques.

Formulation:The SUMO2 (1mg/ml) containing 20mM Tris-HCl buffer (pH 8.0).

Physical Appearance:Sterile filtered colorless solution.

Purity:Greater than 95.0% as determined by SDS-PAGE.

Source:Escherichia Coli.

Stability:Can be stored at +4C for 1 week. For long term storage , below -20C.Please prevent freeze-thaw cycles.

Synonyms: Small ubiquitin-related modifier 2, SUMO-2, Ubiquitin-like protein SMT3B, SMT3 homolog 2, Sentrin-2, HSMT3, SUMO-3, SUMO2, SMT3B, SMT3H2, MGC117191.

Usage:LifeTein's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

  • 4 Units in Stock

Ask a Question

$475.00

Add to Cart:
LifeTein LifeTein provides custom peptide synthesis service, recombinant proteins, peptides, cytokines, custom antibody service and custom protein service. LifeTein is the world leader in fast peptide synthesis service with lab facility located in New Jersey USA. LifeTein Peptide 100 Randolph Road, Suite 2D, Somerset USA New Jersey 08873
Copyright © 2024 LifeTein.com. Powered by LifeTein