|
| RXRB Rabbit mAb |
|
| LTA24768 |
|
| 100ul |
|
|
$750
In stock
|
|
| This gene encodes a member of the retinoid X receptor (RXR) family of nuclear receptors which are involved in mediating the effects of retinoic acid (RA). The encoded protein forms homodimers with the retinoic acid, thyroid hormone, and vitamin D receptors, increasing both DNA binding and transcriptional function on their respective response elements. This gene lies within the major histocompatibility complex (MHC) class II region on chromosome 6. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. |
|
| NR2B2; DAUDI6; RCoR-1; RXRbeta; H-2RIIBP; RXR-beta |
|
| 6257,DAUDI6,H 2RIIBP,NR2B2,RCoR 1,Retinoid X receptor beta,retinoid X receptor,beta,RXRB,H-2RIIBP,RCoR-1,retinoid X receptor beta,retinoic acid receptor RXR-beta,MHC class I promoter binding protein,nuclear receptor subfamily 2 group B member 2,P28702,Retinoid X Receptor Beta,Nuclear Receptor Subfamily 2 Group B Member 2,MHC Class I Promoter Binding Protein,Retinoic Acid Receptor RXR-Beta,Retinoid X Receptor,Beta |
|
| Human |
|
| 6257 |
|
| P28702 |
|
| MSWAARPPFLPQRHAAGQCGPVGVRKEMHCGVASRWRRRRPWLDPAAAAAAAVAGGEQQTPEPEPGEAGRDGMGDSGRDSRSPDSSSPNPLPQGVPPPSP |
|
| A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RXRB (NP_068811.1). |
|
| Rabbit |
|
| Affinity Purified Monoclonal IgG |
|
| IHC-P, ELISA |
|
| Human, Mouse, Rat |
|
| 57kDa |
|
| IHC-P,1:200 - 1:800|ELISA,Recommended starting concentration is 1 _g/mL. Please optimize the concentration based on your specific assay requirements. |
|
|
Reconstituted antibodies stable at -80C for 12 months, 4C for 1 week. Avoid repeated freeze-thaw cycles.
|
|
|
Shipped at ambient temperature.
|
|
|
Centrifuge tubes before opening. Dissolve the lyophilized antibodies in distilled water. 5-10% glycerol is recommended.
|
|
| .jpg )
Immunohistochemistry analysis of paraffin-embedded Human kidney tissue using RXRB Rabbit mAb (LTA24768) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining. |
