|
| Recoverin Rabbit mAb |
|
| LTA24804 |
|
| 100ul |
|
|
$750
In stock
|
|
| This gene encodes a member of the recoverin family of neuronal calcium sensors. The encoded protein contains three calcium-binding EF-hand domains and may prolong the termination of the phototransduction cascade in the retina by blocking the phosphorylation of photo-activated rhodopsin. Recoverin may be the antigen responsible for cancer-associated retinopathy. |
|
| RCV1 |
|
| 5957,sc-20355,sc-20353,sc-28849,Protein CAR,RCV1,RCVRN,recoverin,cancer associated retinopathy antigen,cancer-associated retinopathy protein,P35243,Recoverin,Cancer-Associated Retinopathy Protein,Cancer Associated Retinopathy Antigen |
|
| Human |
|
| 5957 |
|
| P35243 |
|
| MGNSKSGALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDTDPKAYAQHVFRSFDSNLDGTLDFKEYVIALHMTTAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKMKNA |
|
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human Recoverin (NP_002894.1). |
|
| Rabbit |
|
| Affinity Purified Monoclonal IgG |
|
| WB, ELISA |
|
| Human |
|
| 23kDa |
|
| WB,1:2000 - 1:8000|ELISA,Recommended starting concentration is 1 _g/mL. Please optimize the concentration based on your specific assay requirements. |
|
|
Reconstituted antibodies stable at -80C for 12 months, 4C for 1 week. Avoid repeated freeze-thaw cycles.
|
|
|
Shipped at ambient temperature.
|
|
|
Centrifuge tubes before opening. Dissolve the lyophilized antibodies in distilled water. 5-10% glycerol is recommended.
|
|
| .jpg )
Western blot analysis of lysates from wild type (WT) and 293F cells transfected with Recoverin using Recoverin Rabbit mAb (LTA24804) at 1:2000 dilution incubated overnight at 4_.|Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (LT014) at 1:10000 dilution.|Lysates/proteins: 20 _g per lane.|Blocking buffer: 3% nonfat dry milk in TBST.|Detection: ECL Basic Kit (LT00020)|.Exposure time: 30s. |
