|
| Rabbit anti Human IgG4 (Fc) mAb |
|
| LTA24820 |
|
| 100ul |
|
|
$750
In stock
|
|
| Predicted to enable antigen binding activity and immunoglobulin receptor binding activity. Predicted to be involved in several processes, including activation of immune response; defense response to other organism; and phagocytosis. Located in blood microparticle and extracellular exosome. |
|
| IGHG4 |
|
| 3503,human IgG heavy chain,IgG Fc,IGHG,IGHG4,Immunoglobulin heavy chain gamma,immunoglobulin heavy constant gamma 4 (G4m marker),immunoglobulin heavy chain constant region gamma 4,P01861,Immunoglobulin Heavy Constant Gamma 4 (G4m Marker),Immunoglobulin Heavy Chain Constant Region Gamma 4,Ig Gamma-4 Chain C Region |
|
| Human |
|
| 3503 |
|
| P01861 |
|
| ESKYGPPCPSCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLEL |
|
| Recombinant fusion protein containing a sequence corresponding to amino acids 99-327 of human IgG4. |
|
| Rabbit |
|
| Affinity Purified Monoclonal IgG |
|
| WB, ELISA |
|
| Human |
|
| |
|
| WB,1:1000 - 1:4000|ELISA,Recommended starting concentration is 1 _g/mL. Please optimize the concentration based on your specific assay requirements. |
|
|
Reconstituted antibodies stable at -80C for 12 months, 4C for 1 week. Avoid repeated freeze-thaw cycles.
|
|
|
Shipped at ambient temperature.
|
|
|
Centrifuge tubes before opening. Dissolve the lyophilized antibodies in distilled water. 5-10% glycerol is recommended.
|
|
| .jpg )
Western blot analysis of lysates from wild type (WT) and 293F cells transfected with Human IgG4 (Fc) using Rabbit anti Human IgG4 (Fc) mAb (LTA24820) at dilution incubated overnight at 4_.|Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (LT014) at 1:10000 dilution.|Lysates/proteins: 20 _g per lane.|Blocking buffer: 3% nonfat dry milk in TBST.|Detection: ECL Basic Kit (LT00020)|.Exposure time: 3s. |
