My Account Information
Displaying 5061 to 5070 (of 7697 Products)
| Price | Product Name |
|---|---|
$280.00 ... more info |
Catalog Number: 5725 Category: Peptide Sequence: Biotin-SGDGEGEGAEEY Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
CPQGRMRIATEVLKSKPNSSHWHTGIRQKAGS Catalog Number: 5724 Category: Peptide Sequence: CPQGRMRIATEVLKSKPNSSHWHTGIRQKAGS Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5723 Category: Peptide Sequence: GWS Modifications: Quantity: 1mg Purity: 90 % Notes: |
$280.00 ... more info |
Catalog Number: 5722 Category: Peptide Sequence: LQS Modifications: Quantity: 1mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5721 Category: Peptide Sequence: SSL Modifications: Quantity: 1mg Purity: >95% Notes: |
$450.00 ... more info |
Catalog Number: 5720 Category: Peptide Sequence: {D-Ser}LGAEQ Modifications: Quantity: 100mg Purity: >95% Notes: |
$380.00 ... more info |
Catalog Number: 5719 Category: Peptide Sequence: EVSGLEQLESIINFEKLTEWTSSNVME Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5718 Category: Peptide Sequence: SIINFEKL-Cys, SIINFEKL is a well-known epitope derived from the ovalbumin protein (OVA), a major component of egg whites. It represents an 8-amino acid sequence... |
$450.00 ... more info |
Catalog Number: 5717 Category: Peptide Sequence: {Myr}-GWKKQSLPATGQEHHHHHH Modifications: Quantity: 50mg Purity: >95% Notes: |
$320.00 ... more info |
Catalog Number: 5716 Category: Peptide Sequence: Biotin-AALPETG*G, G* = 2-hydroxyacetic acid Modifications: Staphylococcus aureus transpeptidase Sortase A (SrtA) is a promising enzyme for proximal-dependent intercellular labeling. An LPETG... |
Displaying 5061 to 5070 (of 7697 Products)