My Account Information

Displaying 4981 to 4990 (of 7697 Products)
Price Product Name
$450.00
... more info

TENLYFQSGT-Lys(TAMRA)

Catalog Number: 5805 Category: Peptide Sequence: TENLYFQSGT-Lys(TAMRA) Modifications: Quantity: 4mg Purity: >95% Notes: TEV Protease and Its Unique Sequence Specificity : Tobacco Etch Virus (TEV) protease is a highly...
$280.00
... more info

{FITC}-TENLYFQSGTK

Catalog Number: 5804 Category: Peptide Sequence: {FITC}-TENLYFQSGTK Modifications: Quantity: 4mg Purity: >95% Notes: TEV Protease and Its Unique Sequence Specificity : Tobacco Etch Virus (TEV) protease is a highly sequence-specific...
$350.00
... more info

STQSNKKDLCEHYRQIAKESCKKGFLGVRDGTAGACFGAQIMVAAKGC

Catalog Number: 5803 Category: Peptide Sequence: STQSNKKDLCEHYRQIAKESCKKGFLGVRDGTAGACFGAQIMVAAKGC Modifications: Quantity: 4mg Purity: >95% Notes:
$290.00
... more info

KKDAGLYFFRLERGKTKYNYMWDKMTLVVT

Catalog Number: 5802 Category: Peptide Sequence: KKDAGLYFFRLERGKTKYNYMWDKMTLVVT Modifications: Quantity: 4mg Purity: >95% Notes:
$280.00
... more info

LFANGGAGGQGGAGGAGGAGGAGGAGMAAGPAGGTGGIGAIGGIG

Catalog Number: 5801 Category: Peptide Sequence: LFANGGAGGQGGAGGAGGAGGAGGAGMAAGPAGGTGGIGAIGGIG Modifications: Quantity: 4mg Purity: >95% Notes:
$280.00
... more info

TFVSPAAQKAFQPPRSAG

Catalog Number: 5800 Category: Peptide Sequence: TFVSPAAQKAFQPPRSAG Modifications: Quantity: 1-4mg Purity: >95% Notes:
$280.00
... more info

{Ser}LWAKCYRLGQSECAGP

Catalog Number: 5799 Category: Peptide Sequence: {Ser}LWAKCYRLGQSECAGP Modifications: Quantity: 4mg Purity: >95% Notes:
$280.00
... more info

GWYCALSKQEGCRL{Ser}AP

Catalog Number: 5798 Category: Peptide Sequence: GWYCALSKQEGCRL{Ser}AP Modifications: Quantity: 4mg Purity: >95% Notes:
$280.00
... more info

{Myr}-GTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANKVG-HHHHHH

Catalog Number: 5797 Category: Peptide Sequence: {Myr}-GTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANKVG-HHHHHH Modifications: Quantity: 1mg Purity: >95% Notes:
$280.00
... more info

VLLSPLSRV

Catalog Number: 5796 Category: Peptide Sequence: VLLSPLSRV Modifications: Quantity: 4mg Purity: >95% Notes:
Displaying 4981 to 4990 (of 7697 Products)