My Account Information
Displaying 91 to 100 (of 7696 Products)
| Price | Product Name |
|---|---|
$800.00 ... more info |
Curli production assembly transport protein CsgF Product Name Curli production assembly/transport protein CsgF [Escherichia coli] TFQFRNPNFGGNPSNGAFLLNSAQAQNSYKDP- Cys (DBCO) Product Quantity 4mg Catalog Number LT8216 Sequence Curli production assembly/transport protein CsgF... |
$1,200.00 ... more info |
cAMP-dependent protein kinase type II-alpha regulatory subunit Product Name Chain A, cAMP-dependent protein kinase type II-alpha regulatory subunit [Homo sapiens]: HIQIPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARA Product Quantity 4mg Catalog Number LT8215 Sequence Chain A, cAMP-dependent protein kinase... |
$280.00 ... more info |
Product Name RAME (100-108) HLA-A*0201: VLDGLDVLL Product Quantity 4mg Catalog Number LT8214 Formula C44H77N9O14 Molecular Weight 956.15 Sequence RAME (100-108) HLA-A*0201: VLDGLDVLL Product Description PRAME (100-108)... |
$350.00 ... more info |
Product Name NRIP1_700_722: 5' FAM - GSEIENLLERRTVLQLLLGNPNK Product Quantity 4mg Catalog Number LT8212 Molecular Weight 2965.32 Formula C134H206N34O42 Sequence 5' FAM - GSEIENLLERRTVLQLLLGNPNK Product Description... |
$280.00 ... more info |
Product Name VEGF-IQ: Ac-LTYQDLLQLQY-{D-Arg}-NH2, Related products Ac-KLTWQELYQLKYKGI-NH2; Ac-KQLLWIRSGDRPWYTS-NH2 Product Quantity 4mg Catalog Number LT8211 Molecular Weight 1594.81 Sequence Ac- LTYQDLLQLQY-{D-Arg}-NH2 Product... |
$280.00 ... more info |
Product Name VEGF-HPLW: Ac-KQLLWIRSGDRPWYTS-NH2; Related products KLTWQELYQLKYKGI; Ac-LTYQDLLQLQY-{D-Arg}-NH2 Product Quantity 4mg Catalog Number LT8210 Molecular Weight 2047.32 Sequence Ac-KQLLWIRSGDRPWYTS-NH2 Product... |
$280.00 ... more info |
Product Name SARS-CoV2 Spike glycoprotein, Biotin-GD-SFKEELDKYFKNHTS, Biotin modification with spacers Product Quantity 4mg Catalog Number LT8209 Epitope Position 1147-1161 Formula C101H147N25O33S Molecular Weight 2271.49 ... |
$280.00 ... more info |
SV40 Nuclear Transport Signal Peptide Analog Product Name SV40 Nuclear Transport Signal Peptide Analog, CGYGPKKKRKVGG Product Quantity 4mg Catalog Number LT8208 Molecular Weight 1377.66 Formula C60H104N20O15S, Cas#: 104914-40-1 Sequence NH2-CGYGPKKKRKVGG-COOH,... |
$280.00 ... more info |
Product Name Ovalbumin(247-264) antigen peptide Product Description OVA (247-264) is a class I (Kb)-restricted peptide epitope of ovalbumin (OVA), presented by the class I major histocompatibility complex (MHC) molecule, H-2Kb. It is a... |
$299.00 ... more info |
PNA oligos against human globin Product Name PNA oligos against human globin Product Description The PNA oligo Lys-TAACGGTATTTGGAG-Lys is a synthetic peptide nucleic acid (PNA) designed to target human globin mRNA . It binds specifically to globin mRNA sequences, thus blocking... |
Displaying 91 to 100 (of 7696 Products)