My Account Information
Displaying 5401 to 5410 (of 7697 Products)
| Price | Product Name |
|---|---|
$280.00 ... more info |
Catalog Number: 5393 Category: Peptide Sequence: GGIGRKFAPLYVRDRKFDLLQFVNLTR Modifications: Quantity: 1-4mg Purity: >95% Notes: |
$280.00 ... more info |
LTGLGGIGRKFAPLYVRDRKFDLLQFVNLTRSKKQ Catalog Number: 5392 Category: Peptide Sequence: LTGLGGIGRKFAPLYVRDRKFDLLQFVNLTRSKKQ Modifications: Quantity: 1-4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5391 Category: Peptide Sequence: SDPLEGTSRDW Modifications: Quantity: 1-4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5390 Category: Peptide Sequence: SSWDSDPLEGTSRDWQYVP Modifications: Quantity: 1-4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5389 Category: Peptide Sequence: TVGRVATPRIR Modifications: Quantity: 1-4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5388 Category: Peptide Sequence: GFGATVGRVATPRIRSGVV Modifications: Quantity: 1-4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5387 Category: Peptide Sequence: FAM-QLDLF Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5386 Category: Peptide Sequence: TSTVYMELSSLRSED Modifications: Quantity: 1.5mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5385 Category: Peptide Sequence: SVLYSSNNKNYLAWY Modifications: Quantity: 1.5mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5384 Category: Peptide Sequence: STVYMELSSLRSEDT Modifications: Quantity: 1.5mg Purity: >95% Notes: |
Displaying 5401 to 5410 (of 7697 Products)