My Account Information
Displaying 5311 to 5320 (of 7697 Products)
| Price | Product Name |
|---|---|
$280.00 ... more info |
Catalog Number: 5483 Category: Peptide Sequence: AAWGGSGSEA YQGVQQKWDA Modifications: Quantity: 1-4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5482 Category: Peptide Sequence: EGKQSLTKLA AAWGGSGSEA Modifications: Quantity: 1-4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5481 Category: Peptide Sequence: NVTSIHSLLD EGKQSLTKLA Modifications: Quantity: 1-4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5480 Category: Peptide Sequence: IEAAASAIQG NVTSIHSLLD Modifications: Quantity: 1-4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5479 Category: Peptide Sequence: MTEQQWNFAG IEAAASAIQG Modifications: Quantity: 1-4mg Purity: >95% Notes: |
$280.00 ... more info |
KKGFYKKKQCRPSKGRKRGFCWMPKKKPTPIQLNP Catalog Number: 5478 Category: Peptide Sequence: KKGFYKKKQCRPSKGRKRGFCWMPKKKPTPIQLNP Modifications: Quantity: 1-4mg Purity: >95% Notes: |
$280.00 ... more info |
FWVSLNPEWNETKKGFYKKKQCRPSKGRKRGFCW Catalog Number: 5477 Category: Peptide Sequence: FWVSLNPEWNETKKGFYKKKQCRPSKGRKRGFCW Modifications: Quantity: 1-4mg Purity: >95% Notes: |
$340.00 ... more info |
Catalog Number: 5476 Category: Peptide Sequence: ETCHLSPNPYVGCTK Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5475 Category: Peptide Sequence: YPYDVPDYAGEFKQEDMIEIVDILMMQ Modifications: Quantity: 1-4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5474 Category: Peptide Sequence: YPYDVPDYAGEFKQEDMIEAADAAMMQ Modifications: Quantity: 1-4mg Purity: >95% Notes: |
Displaying 5311 to 5320 (of 7697 Products)