My Account Information
Displaying 5091 to 5100 (of 7697 Products)
| Price | Product Name |
|---|---|
$280.00 ... more info |
Catalog Number: 5695 Category: Peptide Sequence: FAFRDLCIVY Modifications: Quantity: 1-4mg Purity: >95% Description: The peptide sequence FAFRDLCIVY has been identified as a novel T-cell epitope in immunological research. This... |
$280.00 ... more info |
Catalog Number: 5694 Category: Peptide Sequence: VYDFAFRDLCIVYRD Modifications: Quantity: 1-4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5693 Category: Peptide Sequence: MVMDIVGFYLPPKSGERVSFKITLL Modifications: Quantity: 1-4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5692 Category: Peptide Sequence: YVCGVSGAILRTICTFTLSFCKDNQ Modifications: Quantity: 1-4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5691 Category: Peptide Sequence: LQDSLGGECQDHHGSHTGASFSQLR Modifications: Quantity: 1-4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5690 Category: Peptide Sequence: RDIRPDFGSWTASRGPF Modifications: Quantity: 1-4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5689 Category: Peptide Sequence: AYWKPSTLVEKWVFKSSTLPQFSLS Modifications: Quantity: 1-4mg Purity: >95% Notes: |
$280.00 ... more info |
Biotin-Ahx-YLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPC Catalog Number: 5688 Category: Peptide Sequence: Biotin-Ahx-YLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPC Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5687 Category: Peptide Sequence: EFD Modifications: Quantity: 1mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5686 Category: Peptide Sequence: YSA Modifications: Quantity: 1mg Purity: >95% Notes: |
Displaying 5091 to 5100 (of 7697 Products)