My Account Information
Displaying 901 to 910 (of 7696 Products)
| Price | Product Name |
|---|---|
$390.00 ... more info |
Biotin-Ahx-PGSAGKSKNELDYENDIEKKICKMEKCSSV Catalog Number: 6248 Category: Peptide Sequence: Biotin-Ahx-PGSAGKSKNELDYENDIEKKICKMEKCSSV Modifications: Quantity: 4mg Purity: >95% Notes: |
$390.00 ... more info |
Biotin-Ahx-PGSANKPKDELDYANDIEKKICKMEKCSSV Catalog Number: 6245 Category: Peptide Sequence: Biotin-Ahx-PGSANKPKDELDYANDIEKKICKMEKCSSV Modifications: Quantity: 4mg Purity: >95% Notes: |
$390.00 ... more info |
Biotin-Ahx-PGSANKPKDELNYENDIEKKICKMEKCSSV Catalog Number: 6251 Category: Peptide Sequence: Biotin-Ahx-PGSANKPKDELNYENDIEKKICKMEKCSSV Modifications: Quantity: 4mg Purity: >95% Notes: |
$390.00 ... more info |
Biotin-Ahx-PGSANKPKDQLDYANDIEKKICKMEKCSSV Catalog Number: 6246 Category: Peptide Sequence: Biotin-Ahx-PGSANKPKDQLDYANDIEKKICKMEKCSSV Modifications: Quantity: 4mg Purity: >95% Notes: |
$390.00 ... more info |
Biotin-Ahx-PGSANKPKDQLDYENDIEKKICKMEKCSSV Catalog Number: 6247 Category: Peptide Sequence: Biotin-Ahx-PGSANKPKDQLDYENDIEKKICKMEKCSSV Modifications: Quantity: 4mg Purity: >95% Notes: |
$390.00 ... more info |
Biotin-Ahx-PGSANKPKDQLNYENDIEKKICKMEKCSSV Catalog Number: 6249 Category: Peptide Sequence: Biotin-Ahx-PGSANKPKDQLNYENDIEKKICKMEKCSSV Modifications: Quantity: 4mg Purity: >95% Notes: |
$250.00 ... more info |
Catalog Number: 5265 Category: Peptide Sequence: biotin-Ahx-PPPPRGDRGDRGD-NH2 Modifications: Quantity: 9.9 mg Purity: >95% Formula: C72H116N26O22S Molecular Weight: 1729.94 Description: This peptide contains multiple repeats of... |
$250.00 ... more info |
Catalog Number: 5264 Category: Peptide Sequence: biotin-Ahx-RKKRRQRRR-NH2 Modifications: Quantity: 4 mg Purity: >95% Formula: C69H132N34O13S Molecular Weight: 1678.1 Description: RKKRRQRRR is a 9-amino acid peptide derived from... |
$250.00 ... more info |
Catalog Number: 5266 Category: Peptide Sequence: biotin-Ahx-RPARPAR-OH Modifications: Quantity: 4 mg Purity: >95% Formula: C50H87N19O11S Molecular Weight: 1162.43 Description: RPARPAR is an 8-amino acid peptide with the sequence... |
$280.00 ... more info |
Biotin-Ahx-YLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPC Catalog Number: 5688 Category: Peptide Sequence: Biotin-Ahx-YLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPC Modifications: Quantity: 4mg Purity: >95% Notes: |
Displaying 901 to 910 (of 7696 Products)
