My Account Information
Displaying 891 to 900 (of 7696 Products)
| Price | Product Name |
|---|---|
$390.00 ... more info |
Biotin-Ahx-NANNAVKNNNNEEPSDQHIEKYIKKIQNSL Catalog Number: 6241 Category: Peptide Sequence: Biotin-Ahx-NANNAVKNNNNEEPSDQHIEKYIKKIQNSL Modifications: Quantity: 4mg Purity: >95% Notes: |
$390.00 ... more info |
Biotin-Ahx-NANNAVKNNNNEEPSDQHIEKYLKIIKNSL Catalog Number: 6242 Category: Peptide Sequence: Biotin-Ahx-NANNAVKNNNNEEPSDQHIEKYLKIIKNSL Modifications: Quantity: 4mg Purity: >95% Notes: |
$420.00 ... more info |
Biotin-Ahx-NANNAVKNNNNEEPSDQHIEKYLKTIQNSL Catalog Number: 6237 Category: Peptide Sequence: Biotin-Ahx-NANNAVKNNNNEEPSDQHIEKYLKTIQNSL Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 6178 Category: Peptide Sequence: Biotin-Ahx-NANP Modifications: Quantity: 4mg Purity: >95% Notes: |
$350.00 ... more info |
Catalog Number: 6179 Category: Peptide Sequence: Biotin-Ahx-NANPNANPNANP Modifications: Quantity: 4mg Purity: >95% Notes: |
$380.00 ... more info |
Biotin-Ahx-NANSAVKNNNNEEPSDKHIKEYLNKIQNSL Catalog Number: 6235 Category: Peptide Sequence: Biotin-Ahx-NANSAVKNNNNEEPSDKHIKEYLNKIQNSL Modifications: Quantity: 4mg Purity: >95% Notes: |
$390.00 ... more info |
Biotin-Ahx-NENANANNAVKNNNNEEPS Catalog Number: 6256 Category: Peptide Sequence: Biotin-Ahx-NENANANNAVKNNNNEEPS Modifications: Quantity: 4mg Purity: >95% Notes: |
$390.00 ... more info |
Biotin-Ahx-PGSADKPKDQLDYINDIEKKICKMEKCSSV Catalog Number: 6250 Category: Peptide Sequence: Biotin-Ahx-PGSADKPKDQLDYINDIEKKICKMEKCSSV Modifications: Quantity: 4mg Purity: >95% Notes: |
$390.00 ... more info |
Biotin-Ahx-PGSADKPKNELDYENDIEKKICKMEKCSSV Catalog Number: 6253 Category: Peptide Sequence: Biotin-Ahx-PGSADKPKNELDYENDIEKKICKMEKCSSV Modifications: Quantity: 4mg Purity: >95% Notes: |
$390.00 ... more info |
Biotin-Ahx-PGSAGKPKNELDYENDIEKKICKMEKCSSV Catalog Number: 6252 Category: Peptide Sequence: Biotin-Ahx-PGSAGKPKNELDYENDIEKKICKMEKCSSV Modifications: Quantity: 4mg Purity: >95% Notes: |
Displaying 891 to 900 (of 7696 Products)
