|
| OTC Rabbit mAb |
|
| LTA24794 |
|
| 100ul |
|
|
$750
In stock
|
|
| This nuclear gene encodes a mitochondrial matrix enzyme. The encoded protein is involved in the urea cycle which functions to detoxify ammonia into urea for excretion. Mutations in this enzyme lead to ornithine transcarbamylase deficiency, which causes hyperammonemia. |
|
| OCTD; OTC1; OTCD; OTCase |
|
| 5009,sc-132401,sc-102051,OTC,OCTD,ornithine carbamoyltransferase,mitochondrial,OTCase,ornithine transcarbamylase,P00480,Ornithine Carbamoyltransferase,Ornithine Transcarbamylase,Mitochondrial,EC 2.1.3.3 |
|
| Human |
|
| 5009 |
|
| P00480 |
|
| LQAATPKGYEPDASVTKLAEQYAKENGTKLLLTNDPLEAAHGGNVLITDTWISMGQEEEKKKRLQAFQGYQVTMKTAKVAASDWTFLHCLPRKPEEVDDEVFYSPRSLVFPEAENRKWTIMAVMVSLLTDYSPQLQKPKF |
|
| Recombinant fusion protein containing a sequence corresponding to amino acids 215-354 of human OTC (NP_000522.3). |
|
| Rabbit |
|
| Affinity Purified Monoclonal IgG |
|
| IF/ICC, ELISA |
|
| Human |
|
| 40kDa |
|
| IF/ICC,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 _g/mL. Please optimize the concentration based on your specific assay requirements. |
|
|
Reconstituted antibodies stable at -80C for 12 months, 4C for 1 week. Avoid repeated freeze-thaw cycles.
|
|
|
Shipped at ambient temperature.
|
|
|
Centrifuge tubes before opening. Dissolve the lyophilized antibodies in distilled water. 5-10% glycerol is recommended.
|
|
| .jpg )
Confocal imaging of paraffin-embedded Human liver tissue using OTC Rabbit mAb (LTA24794, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (LT007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x. |
