|
| Orexin B Rabbit mAb |
|
| LTA24754 |
|
| 100ul |
|
|
$750
In stock
|
|
| This gene encodes a hypothalamic neuropeptide precursor protein that gives rise to two mature neuropeptides, orexin A and orexin B, by proteolytic processing. Orexin A and orexin B, which bind to orphan G-protein coupled receptors HCRTR1 and HCRTR2, function in the regulation of sleep and arousal. This neuropeptide arrangement may also play a role in feeding behavior, metabolism, and homeostasis. |
|
| OX; PPOX; NRCLP1 |
|
| 3060,sc-26491,sc-33339,sc-8070,sc-8071,sc-28935,HCRT,NRCLP1,OX,PPOX,hypocretin neuropeptide precursor,orexin,hypocretin (orexin) neuropeptide,prepro-orexin,O43612,Hypocretin Neuropeptide Precursor,Prepro-Orexin,Orexin,Hypocretin (Orexin) Neuropeptide Precursor,Hypocretin (Orexin) Neuropeptide,Hypocretin,PPORX,Hcrt |
|
| Human |
|
| 3060 |
|
| O43612 |
|
| MNLPSTKVSWAAVTLLLLLLLLPPALLSSGAAAQPLPDCCRQKTCSCRLYELLHGAGNHAAGILTLGKRRSGPPGLQGRLQRLLQASGNHAAGILTMGRR |
|
| A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Orexin B 0. |
|
| Rabbit |
|
| Affinity Purified Monoclonal IgG |
|
| WB, ELISA |
|
| Human |
|
| 13kDa |
|
| WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 _g/mL. Please optimize the concentration based on your specific assay requirements. |
|
|
Reconstituted antibodies stable at -80C for 12 months, 4C for 1 week. Avoid repeated freeze-thaw cycles.
|
|
|
Shipped at ambient temperature.
|
|
|
Centrifuge tubes before opening. Dissolve the lyophilized antibodies in distilled water. 5-10% glycerol is recommended.
|
|
| .jpg )
Western blot analysis of lysates from wild type (WT) and 293F cells transfected with Orexin B using Orexin B Rabbit mAb (LTA24754) at 1:1000 dilution incubated overnight at 4_.|Secondary antibody: () at 1:10000 dilution.|Lysates/proteins: 20 _g per lane.|Blocking buffer: 3% nonfat dry milk in TBST.|Detection: ECL Enhanced Kit (LT00021)|.Exposure time: 90s. |
