|
| Nephrin Rabbit mAb |
|
| LTA24745 |
|
| 100ul |
|
|
$750
In stock
|
|
| This gene encodes a member of the immunoglobulin family of cell adhesion molecules that functions in the glomerular filtration barrier in the kidney. The gene is primarily expressed in renal tissues, and the protein is a type-1 transmembrane protein found at the slit diaphragm of glomerular podocytes. The slit diaphragm is thought to function as an ultrafilter to exclude albumin and other plasma macromolecules in the formation of urine. Mutations in this gene result in Finnish-type congenital nephrosis 1, characterized by severe proteinuria and loss of the slit diaphragm and foot processes. |
|
| CNF; NPHN; nephrin |
|
| 4868,sc-19000,sc-32529,sc-32530,sc-32532,sc-28192,NPHS1,CNF,NPHN,nephrin,nephrosis 1,congenital,Finnish type (nephrin),renal glomerulus-specific cell adhesion receptor,truncated NPHS1,O60500,Nephrin,Renal Glomerulus-Specific Cell Adhesion Receptor,Nephrosis 1,Congenital,Finnish Type (Nephrin),Truncated NPHS1 |
|
| Human |
|
| 4868 |
|
| O60500 |
|
| LGDSGLADKGTQLPITTPGLHQPSGEPEDQLPTEPPSGPSGLPLLPVLFALGGLLLLSNASCVGGVLWQRRLRRLAEGISEKTEAGSEEDRVRNEYEESQWTGERDTQSSTVSTTEAEPYYRSLRDFSPQLPPTQEEVSYSRGFTGEDEDMAFPGHLYDEVERTYPPSGAWGPLYDEVQMGPWDLHWPEDTYQDPRGIYDQVAGDLDTLEPDSLPFELRGHLV |
|
| Recombinant fusion protein containing a sequence corresponding to amino acids 1019-1241 of human Nephrin (NP_004637.1). |
|
| Rabbit |
|
| Affinity Purified Monoclonal IgG |
|
| WB, ELISA |
|
| Human |
|
| 135kDa |
|
| WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 _g/mL. Please optimize the concentration based on your specific assay requirements. |
|
|
Reconstituted antibodies stable at -80C for 12 months, 4C for 1 week. Avoid repeated freeze-thaw cycles.
|
|
|
Shipped at ambient temperature.
|
|
|
Centrifuge tubes before opening. Dissolve the lyophilized antibodies in distilled water. 5-10% glycerol is recommended.
|
|
| .jpg )
Western blot analysis of lysates from A-549 cells using Nephrin Rabbit mAb (LTA24745) at 1:1000 dilution incubated overnight at 4_.|Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (LT014) at 1:10000 dilution.|Lysates/proteins: 25 _g per lane.|Blocking buffer: 3% nonfat dry milk in TBST.|Detection: ECL Enhanced Kit (LT00021).|Exposure time: 90s. |
