|
| NCR3 Rabbit mAb |
|
| LTA24764 |
|
| 100ul |
|
|
$750
In stock
|
|
| The protein encoded by this gene is a natural cytotoxicity receptor (NCR) that may aid NK cells in the lysis of tumor cells. The encoded protein interacts with CD3-zeta (CD247), a T-cell receptor. A single nucleotide polymorphism in the 5' untranslated region of this gene has been associated with mild malaria suceptibility. Three transcript variants encoding different isoforms have been found for this gene. |
|
| 1C7; MALS; CD337; LY117; NKp30 |
|
| 259197,sc-20476,sc-20477,NCR3,1C7,CD337,LY117,MALS,NKp30,natural cytotoxicity triggering receptor 3,NK-p30,activating NK-A1 receptor,activating natural killer receptor p30,lymphocyte antigen 117,natural killer cell p30-related protein,O14931,Natural Cytotoxicity Triggering Receptor 3,Natural Killer Cell P30-Related Protein,Activating Natural Killer Receptor P30,Lymphocyte Antigen 117,NK-P30,Activating NK-A1 Receptor,CD337 Antigen |
|
| Human |
|
| 259197 |
|
| O14931 |
|
| LWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLG |
|
| Recombinant fusion protein containing a sequence corresponding to amino acids 19-135 of human NCR3 (NP_667341.1). |
|
| Rabbit |
|
| Affinity Purified Monoclonal IgG |
|
| IF/ICC, ELISA |
|
| Human |
|
| 22kDa |
|
| IF/ICC,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 _g/mL. Please optimize the concentration based on your specific assay requirements. |
|
|
Reconstituted antibodies stable at -80C for 12 months, 4C for 1 week. Avoid repeated freeze-thaw cycles.
|
|
|
Shipped at ambient temperature.
|
|
|
Centrifuge tubes before opening. Dissolve the lyophilized antibodies in distilled water. 5-10% glycerol is recommended.
|
|
| .jpg )
Confocal imaging of 293T cells transfected with NCR3 using NCR3 Rabbit mAb (LTA24764, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (LT007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 100x. |
