|
| MAVS Rabbit mAb |
|
| LTA24761 |
|
| 100ul |
|
|
$750
In stock
|
|
| This gene encodes an intermediary protein necessary in the virus-triggered beta interferon signaling pathways. It is required for activation of transcription factors which regulate expression of beta interferon and contributes to antiviral innate immunity. |
|
| IPS1; VISA; IPS-1; CARDIF |
|
| 57506,sc-70096,sc-68926,CARDIF,IPS 1,IPS1,KIAA1271,MAVS,VISA,IPS-1,mitochondrial antiviral signaling protein,mitochondrial antiviral-signaling protein,CARD adapter inducing interferon beta,CARD adaptor inducing IFN-beta,IFN-B promoter stimulator 1,interferon beta promoter stimulator protein 1,putative NF-kappa-B-activating protein 031N,virus-induced signaling adaptor,virus-induced-signaling adapter,Q7Z434,Mitochondrial Antiviral Signaling Protein,Interferon Beta Promoter Stimulator Protein 1,Putative NF-Kappa-B-Activating Protein 031N,CARD Adapter Inducing Interferon Beta,Virus-Induced-Signaling Adapter,Virus-Induced Signaling Adaptor,CARD Adaptor Inducing IFN-Beta,IFN-B Promoter Stimulator 1,Mitochondrial Antiviral-Signaling Protein,Cardif |
|
| Human |
|
| 57506 |
|
| Q7Z434 |
|
| SLPAERPGPPTPAAAHSIPYNSCREKEPSYPMPVQETQAPESPGENSEQALQTLSPRAIPRNPDGGPLESSSDLAALSPLTSSGHQEQDTELGSTHTAGA |
|
| A synthetic peptide corresponding to a sequence within amino acids 111-210 of human MAVS (NP_065797.2). |
|
| Rabbit |
|
| Affinity Purified Monoclonal IgG |
|
| WB, ELISA |
|
| Human, Mouse, Rat |
|
| 57kDa |
|
| WB,1:1000 - 1:2000|ELISA,Recommended starting concentration is 1 _g/mL. Please optimize the concentration based on your specific assay requirements. |
|
|
Reconstituted antibodies stable at -80C for 12 months, 4C for 1 week. Avoid repeated freeze-thaw cycles.
|
|
|
Shipped at ambient temperature.
|
|
|
Centrifuge tubes before opening. Dissolve the lyophilized antibodies in distilled water. 5-10% glycerol is recommended.
|
|
| .jpg )
Western blot analysis of lysates from Mouse liver using MAVS Rabbit mAb (LTA24761) at 1:2000 dilution incubated overnight at 4_.|Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (LT014) at 1:10000 dilution.|Lysates/proteins: 25 _g per lane.|Blocking buffer: 3% nonfat dry milk in TBST.|Detection: ECL Basic Kit (LT00020).|Exposure time: 180s. |
