|
| [KD Validated] POLR2L Rabbit mAb |
|
| LTA24787 |
|
| 100ul |
|
|
$750
In stock
|
|
| This gene encodes a subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. The product of this gene contains four conserved cysteines characteristic of an atypical zinc-binding domain. Like its counterpart in yeast, this subunit may be shared by the other two DNA-directed RNA polymerases. |
|
| RBP10; RPB10; RPABC5; RPB7.6; hRPB7.6; RPB10beta |
|
| 5441,POLR2L,RBP10,RPABC5,RPB10,RPB10beta,RPB7.6,hRPB7.6,RNA polymerase II subunit L,DNA-directed RNA polymerases I,II,and III subunit RPABC5,DNA-directed RNA polymerase III subunit L,RNA polymerase II 7.6 kDa subunit,RNA polymerases I,and III subunit ABC5,RPB10 homolog,polymerase (RNA) II (DNA directed) polypeptide L,7.6kDa,polymerase (RNA) II subunit L,P62875,RNA Polymerase II Subunit L,Polymerase (RNA) II (DNA Directed) Polypeptide L,RNA Polymerases I,And III Subunit ABC5,DNA-Directed RNA Polymerase III Subunit L,RNA Polymerase II 7.6 KDa Subunit,RPB10 Homolog,DNA-Directed RNA Polymerases I,And III Subunit RPABC5,Polymerase (RNA) II Subunit L,HRPB7.6 |
|
| Human |
|
| 5441 |
|
| P62875 |
|
| MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLLNYAPLEK |
|
| A synthetic peptide corresponding to a sequence within amino acids 1-67 of human POLR2L (NP_066951.1). |
|
| Rabbit |
|
| Affinity Purified Monoclonal IgG |
|
| WB, ELISA |
|
| Human, Mouse, Rat |
|
| 8kDa |
|
| WB,1:2000 - 1:12000|ELISA,Recommended starting concentration is 1 _g/mL. Please optimize the concentration based on your specific assay requirements. |
|
|
Reconstituted antibodies stable at -80C for 12 months, 4C for 1 week. Avoid repeated freeze-thaw cycles.
|
|
|
Shipped at ambient temperature.
|
|
|
Centrifuge tubes before opening. Dissolve the lyophilized antibodies in distilled water. 5-10% glycerol is recommended.
|
|
| ![[KD Validated] POLR2L Rabbit mAb]( /peptide-product/images/antibody-products/LTA24787/LTA24787_WB_01_(1166533).jpg )
Western blot analysis of various lysates using [KD Validated] POLR2L Rabbit mAb (LTA24787) at 1:2000 dilution incubated overnight at 4_.|Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (LT014) at 1:10000 dilution.|Lysates/proteins: 25 _g per lane.|Blocking buffer: 3% nonfat dry milk in TBST.|Detection: ECL Basic Kit (LT00020).|Exposure time: 15s. |
