
We provide cytokines, growth factors, chemokines, CD antigens, neurotrophins, hormones, enzymes, viral antigens, recombinant proteins, natural proteins, monoclonal antibodies, and polyclonal antibodies.

Please search for your products from here!

Featured Proteins of Coronavirus Disease 2019 (COVID-19): SARS-CoV-2 Spike RBD Protein, Nucleocapsid Protein, ACE2 Protein

Recombinant SARS-CoV-2 Spike S Protein
Recombinant SARS-CoV-2 Furin TMPRSS2 COVID19

Schematic of the SARS-CoV-2 structure; the illustration of the virus is available at doi:

Peptides for COVID-19 Research

LT55782019 Coronavirus SARS-CoV-2 Receptor Binding Motif  $990     $499,  In Stock
LT5587Coronavirus SARS-CoV-2 Surface Glycoprotein, 74 amino acids  $1000     $100,  In Stock
LT5588South Africa Mutant B.1.1.529: Coronavirus SARS-CoV-2 Surface Glycoprotein, 74 amino acids  $1000  
LT-V007SBP1: Peptide binder to the SARS-CoV-2 spike protein$450, In Stock
LT-V008Biotin-SBP1: Biotin-Peptide binder to the SARS-CoV-2 spike protein$450, In Stock
LT-V012SARS-CoV-2 Receptor Binding Domain Overlapping Peptide Library, 22 Peptides, 15mer, 5 amino acid overlapping  $1980     $1386,  In Stock
LT-V013SARS-CoV-2 Receptor Binding Domain Peptide Library, 4 Peptides, 20mer without overlapping$499,  In Stock
LT-V014Angiotensin-converting enzyme 2 (ACE2) substrates and peptidesCall for Quote,  2-3 weeks
LT-V015Aviptadil (Senatek), Vasoactive intestinal polypeptideCall for Quote,  2-3 weeks
LT-V016CTDpS7 pS7-CTD RNA polymerase II carboxy-terminal domainCall for Quote,  2-3 weeks

Introducing: PepMag Conjugation Magnetic Agarose, 10% bead suspension.    

Magnetic bead peptide pulldown

Order PepMag Magnetic Agarose beads for easy peptide conjugation, pull down experiment and binding assays. Simply mix the agarose beads with your peptide through reactions with the amine (NH2-) or thiol (-SH) groups on the peptide. The high surface area of porous magnetic nano-superparamagnetic beads results in high binding capacities. The binding of peptide and magnetic beads is permanent. For binding with your target protein or antibody, simply mix the conjugated beads with your samples, Wash the beads and elute the protein or antibody using 50 mM glycine pH 2.5. Any buffer that breaks the binding between peptide/protein or peptide/antibody can be used for elution.

Multiple tag control protein


LT12005Stearyl-R8$260 $150
LTP4418Recombinant Mouse RANKL Protein$1000 $500
download pdf data sheet
LT13501 Macrophage Colony Stimulating Factor (M-CSF)$650 $300
download pdf data sheet
LTCY-0001Mannose-6-phosphate isomerase$1500 $950
LT0425MultiTag Control Protein for Western Blot$250 $149download pdf data sheet
35796Cys(Npys)-(Arg)9: C(Npys)RRRRRRRRR - NH2$280 $220
LT110006Amylin (1 - 37), human$400 $199
LT2460 Beta-Amyloid (1-42), human$200 $89
L33 Beta-Amyloid (12-28), human$200 $85
L34 Beta-Amyloid (13-28), human$200 $80

Buy one FLAG antibody, Get one FLAG peptide for free. Choice of FLAG peptide or FLAG-Cysteine peptide. Use Code FREEFLAG When Checkout.

Order anti-DYKDDDDK monoclonal antibody from here.

Antibody Products:

Cat. No
Product Name
         Data Sheet
Monoclonal Antibody

Buy one FLAG antibody,
Get one FLAG peptide for free.
Use Code: FREEFLAG When Checkout.
Dot, ELISA, IS, IP, WB  $190     $150  
download pdf data sheet
add to cart
LT0426Anti His Monoclonal AntibodyDot, ELISA, IP, IS, WB   $190     $80  
download pdf data sheet
add to cart
LT0422Anti HA Monoclonal AntibodyDot, ELISA, IP, IS, WB$150
download pdf data sheet
add to cart
LT0421Anti cMyc Monoclonal AntibodyDot, ELISA, IP, IS, WB  $210     $150  
download pdf data sheet
add to cart
 LT0423Anti GST Monoclonal AntibodyDot, ELISA, IP, IS, WB  $220     $150  
download pdf data sheet
add to cart
 LT9992Anti V5 Monoclonal AntibodyDot, ELISA, IP, IS, WB$150
download pdf data sheet
add to cart
 LT9993Anti RFP Monoclonal AntibodyDot, ELISA, IP, IS, WB$200
download pdf data sheet
add to cart
LT9994 Anti GFP Monoclonal Antibody Dot, ELISA, IP, IS, WB $200    
download pdf data sheet
add to cart
LT9999Anti β-Actin Monoclonal AntibodyDot, ELISA, IS, WB$250 
download pdf data sheet
add to cart
 LT9995Anti GAPDH Monoclonal AntibodyDot, ELISA, IS, WB$250
download pdf data sheet
add to cart
LT9991Anti β Tubulin Monoclonal AntibodyDot, ELISA, IS, WB$250
download pdf data sheet
add to cart
 LT9998Anti ERK1 (E19) Monoclonal AntibodyIP, WB$300 
download pdf data sheet
add to cart
 LT9997Anti ERK1 (E32) Monoclonal AntibodyIP, WB$300 
download pdf data sheet
add to cart
 LT9996Anti ERK1/2 Monoclonal AntibodyWB$300
download pdf data sheet
add to cart
... more info


Catalog Number: 5576 Category: Peptide Sequence: Lys(Azide)-RAKAR-Lys(Azide), N-Terminal: Acetylation (Ace), C-Terminal: Amidation ...
... more info


Catalog Number: 5575 Category: Peptide Sequence: RAK-Lys(Azide), N-Terminal: Acetylation (Ace), C-Terminal: Amidation Modifications: ...
... more info


Catalog Number: Desmethylofloxacin derivative, Ciprofloxacin derivative, CAS Number: 82419-46-3 Category: Peptide Sequence:...
... more info


Catalog Number: 5680 Category: Peptide Sequence: KGPSQPTYPGDDAPVRDLIRFYRDLRRYLNVVTRHRY, N-Terminal: Acetylation (Ace), C-Terminal: Amidation ...
... more info


Catalog Number: 5601 Category: Peptide Sequence: Ac-KIDVPWAGQYITSNPAIRFVSIDNKKRNIESSEIGP-NH2 Modifications: Quantity: 200mg Purity: 95.37...
... more info


Catalog Number: 5427 Category: Peptide Sequence: ACDTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSKAF - NH2, Disulfide Bridge: 2-7 Modifications: Quantity: ...
... more info


Catalog Number: 5807 Category: Peptide Sequence: Lys(Azide)-TEELRVRLASHLRKLRKRLLR, DSPE-PEG(2000)-DBCO conjugation Modifications: Quantity: ...
... more info


Catalog Number: 6273 Category: Peptide Sequence: {Sulfo-Cy7.5}-GRDGPQGIWGQDRC, Sulfo-Cy7.5 NHS conjugation on N-terminal amine Modifications: ...
... more info


Catalog Number: 6215 Category: Peptide Sequence: EKRTRIPYKPNYSLNLWSIMKNCIGKELSKIPMPVNFNEPLSMLQRLTEDLEYHE-Lys(Biotin) Modifications: Quantity:...
... more info


Catalog Number: 6096 Category: Peptide Sequence: Cys-Phe-Glu-Lys-Leu-Lys(Azide), Methyltetrazine-PEG4-Maleimide Conjugation on Cysteine,...
Copyright © 2023 Powered by LifeTein