|
| ILT4 Rabbit mAb |
|
| LTA24818 |
|
| 100ul |
|
|
$750
In stock
|
|
| This gene is a member of the leukocyte immunoglobulin-like receptor (LIR) family, which is found in a gene cluster at chromosomal region 19q13.4. The encoded protein belongs to the subfamily B class of LIR receptors which contain two or four extracellular immunoglobulin domains, a transmembrane domain, and two to four cytoplasmic immunoreceptor tyrosine-based inhibitory motifs (ITIMs). The receptor is expressed on immune cells where it binds to MHC class I molecules on antigen-presenting cells and transduces a negative signal that inhibits stimulation of an immune response. It is thought to control inflammatory responses and cytotoxicity to help focus the immune response and limit autoreactivity. Multiple transcript variants encoding different isoforms have been found for this gene. |
|
| ILT4; LIR2; CD85D; ILT-4; LIR-2; MIR10; MIR-10 |
|
| 10288,sc-33454,sc-33455,sc-33456,LILRB2,CD85D,ILT-4,ILT4,LIR-2,LIR2,MIR-10,MIR10,leukocyte immunoglobulin like receptor B2,leukocyte immunoglobulin-like receptor subfamily B member 2,CD85 antigen-like family member D,Ig-like transcript 4,leucocyte Ig-like receptor B2,leukocyte immunoglobulin-like receptor,subfamily B (with TM and ITIM domains),member 2,monocyte/macrophage immunoglobulin-like receptor 10,myeloid inhibitory receptor 10,Q8N423,Leukocyte Immunoglobulin Like Receptor B2,Leukocyte Immunoglobulin-Like Receptor,Subfamily B (With TM And ITIM Domains),Member 2,Monocyte/Macrophage Immunoglobulin-Like Receptor 10,CD85 Antigen-Like Family Member D,Myeloid Inhibitory Receptor 10,Leucocyte Ig-Like Receptor B2,Leukocyte Immunoglobulin-Like Receptor Subfamily B Member 2,Leukocyte Immunoglobulin-Like Receptor 2,Immunoglobulin-Like Transcript 4,Ig-Like Transcript 4,CD85d Antigen |
|
| Human |
|
| 10288 |
|
| Q8N423 |
|
| QTGTIPKPTLWAEPDSVITQGSPVTLSCQGSLEAQEYRLYREKKSASWITRIRPELVKNGQFHIPSITWEHTGRYGCQYYSRARWSELSDPLVLVMTGAYPKPTLSAQPSPVVTSGGRVTLQCESQVAFGGFILCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPNRRWSHRCYGYDLNSPYVWSSPSDLLELLVPGVSKKPSLSVQPGPVMAPGESLTLQCVSDVGYDRFVLYKEGERDLRQLPGRQPQAGL |
|
| Recombinant fusion protein containing a sequence corresponding to amino acids 22-461 of human ILT4 (NP_001074447.2). |
|
| Rabbit |
|
| Affinity Purified Monoclonal IgG |
|
| IF/ICC, ELISA |
|
| Human |
|
| 65kDa |
|
| IF/ICC,1:200 - 1:800|ELISA,Recommended starting concentration is 1 _g/mL. Please optimize the concentration based on your specific assay requirements. |
|
|
Reconstituted antibodies stable at -80C for 12 months, 4C for 1 week. Avoid repeated freeze-thaw cycles.
|
|
|
Shipped at ambient temperature.
|
|
|
Centrifuge tubes before opening. Dissolve the lyophilized antibodies in distilled water. 5-10% glycerol is recommended.
|
|
| .jpg )
Confocal imaging of 293F cells transfected with ILT4 using ILT4 Rabbit mAb (LTA24818, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (LT007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 100x. |
