|
| IL33 Rabbit mAb |
|
| LTA24728 |
|
| 100ul |
|
|
$750
In stock
|
|
| The protein encoded by this gene is a cytokine that binds to the IL1RL1/ST2 receptor. The encoded protein is involved in the maturation of Th2 cells and the activation of mast cells, basophils, eosinophils and natural killer cells. Several transcript variants encoding different isoforms have been found for this gene. |
|
| DVS27; IL1F11; NF-HEV; NFEHEV; C9orf26 |
|
| 90865,sc-83411,sc-98659,C9orf26,DVS27,IL 1F11,IL 33,IL1F11,IL33,Interleukin 1 family member 11,interleukin 33,NF HEV,NFEHEV,NFHEV,RP11 575C20.2,NF-HEV,interleukin-33,DVS27-related protein,interleukin-1 family member 11,nuclear factor for high endothelial venules,nuclear factor from high endothelial venules,O95760,Il33,Interleukin 33,Nuclear Factor From High Endothelial Venules,Nuclear Factor For High Endothelial Venules,Interleukin-1 Family Member 11,DVS27-Related Protein,Chromosome 9 Open Reading Frame 26 (NF-HEV),Interleukin-1 Family,Member 11,Interleukin-33,IL-1F11,IL-33 |
|
| Human |
|
| 90865 |
|
| O95760 |
|
| HDSSITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET |
|
| Recombinant fusion protein containing a sequence corresponding to amino acids 109-270 of human IL33 (NP_001300974.1). |
|
| Rabbit |
|
| Affinity Purified Monoclonal IgG |
|
| IF/ICC, ELISA |
|
| Human |
|
| 31kDa |
|
| IF/ICC,1:200 - 1:800|ELISA,Recommended starting concentration is 1 _g/mL. Please optimize the concentration based on your specific assay requirements. |
|
|
Reconstituted antibodies stable at -80C for 12 months, 4C for 1 week. Avoid repeated freeze-thaw cycles.
|
|
|
Shipped at ambient temperature.
|
|
|
Centrifuge tubes before opening. Dissolve the lyophilized antibodies in distilled water. 5-10% glycerol is recommended.
|
|
| .jpg )
Immunofluorescence analysis of 293F cells transfected with IL33 using IL33 Rabbit mAb (LTA24728) at a dilution of 1:200 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L)(LT007) at 1:500 dilution. Blue: DAPI for nuclear staining. |
