|
| IL-1 alpha Rabbit mAb |
|
| LTA24806 |
|
| 100ul |
|
|
$750
In stock
|
|
| The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is a pleiotropic cytokine involved in various immune responses, inflammatory processes, and hematopoiesis. This cytokine is produced by monocytes and macrophages as a proprotein, which is proteolytically processed and released in response to cell injury, and thus induces apoptosis. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. It has been suggested that the polymorphism of these genes is associated with rheumatoid arthritis and Alzheimer's disease. |
|
| IL1; IL-1A; IL1F1; IL1-ALPHA; IL-1 alpha |
|
| 3552,sc-12741,sc-32814,sc-7929,Hematopoietin 1,IL 1 alpha,IL 1A,IL1,IL1 ALPHA,IL1A,IL1F1,Interleukin 1 alpha,interleukin 1,alpha,IL-1A,IL1-ALPHA,interleukin 1 alpha,interleukin-1 alpha,IL-1 alpha,hematopoietin-1,preinterleukin 1 alpha,pro-interleukin-1-alpha,P01583,Interleukin 1 Alpha,Hematopoietin-1,Pro-Interleukin-1-Alpha,Preinterleukin 1 Alpha,IL-1 Alpha,Interleukin-1 Alpha |
|
| Human |
|
| 3552 |
|
| P01583 |
|
| SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA |
|
| Recombinant fusion protein containing a sequence corresponding to amino acids 113-271 of human IL-1 alpha (NP_000566.3). |
|
| Rabbit |
|
| Affinity Purified Monoclonal IgG |
|
| WB, ELISA |
|
| Human |
|
| 31kDa |
|
| WB,1:1000 - 1:2000|ELISA,Recommended starting concentration is 1 _g/mL. Please optimize the concentration based on your specific assay requirements. |
|
|
Reconstituted antibodies stable at -80C for 12 months, 4C for 1 week. Avoid repeated freeze-thaw cycles.
|
|
|
Shipped at ambient temperature.
|
|
|
Centrifuge tubes before opening. Dissolve the lyophilized antibodies in distilled water. 5-10% glycerol is recommended.
|
|
| .jpg )
Western blot analysis of lysates from Recombinant Human IL-1 alpha Protein (RP00098) using IL-1 alpha Rabbit mAb (LTA24806) at 1:2000 dilution incubated overnight at 4_.|Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (LT014) at 1:10000 dilution.|Lysates/proteins: 10ng,5ng _g per lane.|Blocking buffer: 3% nonfat dry milk in TBST.|Detection: ECL Basic Kit (LT00020).|Exposure time: 90s. |
